Identifiers and Description

Gene Model Identifier

Contig13254.0.g75

Standard Name

PTLS1

Aliases

Contig13254_0_g75

Description

Phage terminase large subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13254.0.g75(coding)
ATGATGTTCTTGGTTCCCTTGGGTTATTTCTACGGTCGAGAGCATATTTTGAACTTCCAG
AACAACATATACTATAAACTGTTTGGAATTAAGGAGCAGCACTTATAGTAGTATAAATAG
AAATTGTTGGACTTGGAGAAACAGGATTAGGAAAAATTGATGTAAATAGAGAAAGAACTA
AAATAATTGTAGAGTGCTGAGGACTCTAAAAGTAAAGATGAGAGTGATCCAATGACTTAG
AAGCCAAATATTGTTTGA


>Contig13254.0.g75(protein)
MMFLVPLGYFYGREHILNFQNNIYYKLFGIKEQHLQQYKQKLLDLEKQDQEKLMQIEKEL
KQLQSAEDSKSKDESDPMTQKPNIV