Identifiers and Description

Gene Model Identifier

Contig5337.0.g28

Standard Name

PTH2b

Aliases

Contig5337_0_g28

Description

Peptidyl-tRNA hydrolase PTH2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006702093.998609120989657e-17Peptidyl-tRNA hydrolase 2, mit
ochondrial prec...
SGDYBL057C2.9992476920535046e-16PTH2 SGDID:S000000153, Chr II
from 113427-112801, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5337.0.g28(coding)
ATGTCTGAAACTACTATTAGCACTGAACCCACTTTGGATTAATAAGTGTTTCAACCTACA
TAAGAAGACCAGAAAACTTAAAACGTTTAAGAATCCCAATAAATTTTATAAGATTCCCAG
ATTTAAGATCAAAACGCAGTAGCTGAAGTATAAGAATCTTAGACCAGCACAGCTTTATAA
GAATCAAATATGGGATTTAAGTTGCATGTTATAATCAGGTTGGATCTGGGGATGACCAAA
GGTAAAATATGCGCTTAGGCATCACATGCAGTGCTGGGTCTGTATAAAGATCTTATGGAA
ACTAACCCTGTGCTCTTCGCTTAATGGGCTTCCCTAGATTTCCCCCAATAGACATATGAA
GCACACAGTTTGTAAGAATTAGAGTCAGCAGATCAAGAAGCAGAAAACTTAGAACTTGAA
AGTTTCATGGTTTACGATGCAGGAAGGACTTAAATCGCAGCAGGGTCTGGAACAGTATGT
GCAATAGGCCCTTGTGAAACAGAATTTATTAGACATATCTTAGAGAAACATAACATTTTG
GAGTGA


>Contig5337.0.g28(protein)
MSETTISTEPTLDQQVFQPTQEDQKTQNVQESQQILQDSQIQDQNAVAEVQESQTSTALQ
ESNMGFKLHVIIRLDLGMTKGKICAQASHAVLGLYKDLMETNPVLFAQWASLDFPQQTYE
AHSLQELESADQEAENLELESFMVYDAGRTQIAAGSGTVCAIGPCETEFIRHILEKHNIL
E