Identifiers and Description

Gene Model Identifier

Contig1451.1.g14

Standard Name

PTH2a

Aliases

Contig1451_1_g14

Description

Peptidyl-tRNA hydrolase PTH2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01981 ) Peptidyl-tRNA hydrolase PTH2
  • ( pfam13980 ) Uncharacterised protein family (UPF0370)
  • ( pfam08555 ) Eukaryotic family of unknown function (DUF1754)
  • ( pfam06610 ) Protein of unknown function (DUF1144)
  • ( pfam11022 ) Protein of unknown function (DUF2611)
  • ( pfam04277 ) Oxaloacetate decarboxylase, gamma chain
  • ( pfam05529 ) B-cell receptor-associated protein 31-like
  • ( pfam12669 ) Virus attachment protein p12 family
  • ( pfam10446 ) Protein of unknown function (DUF2457)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006702091.9994920269952867e-34Peptidyl-tRNA hydrolase 2, mit
ochondrial prec...
SGDYBL057C4.0013320766793207e-25PTH2 SGDID:S000000153, Chr II
from 113427-112801, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1451.1.g14(coding)
ATGAGTGAAGTTCTTGTCTGGGTTATTTTGGGTGTCATTATTGGGCTATTCGTTGACATT
GTAAGAAAGATGTTTAAGAAAGACTAATAAAAGAAGAAAGTTAGATCTAAGAAACTGAAA
AGCAAAAATGAGGAAGAGGATGAAATGGTTGAAGAATCAGATTGGGTAGATGACGACAGC
GATGAAGACCAAGTGAACTCTGCAGACGGTTCTAAGAGAATCAAGGATGAGGTGTTATTT
GAGTCATATCCCATTTAAGACGTCAAGATGGTACTCATAGTGAGAGAAGACTTGAAAATG
GGCAAAGGTAAAATTGGAGCTCAATGCGGACATGCAACTCTAGGTGCTTACAAGCAGTGC
GAGAAATACTCAAAAGATAGCGATTACTGGAAGAAAGTACTAAATAACTGGTCTTGGGAA
GGTCAAAAGAAGATTTGTGTTAAAGTTAACTCTGAACAAGAATTACTTGATCTCTAAAGC
AAAGCTAAGGAAAAGGCTATTCCTGCTTATGTTGTGGCAGACGCTGGACTTACTCAAATC
AAAGAAGGATCCTTAACTGTGTGTGGATTAGGCCCTGCTCCCACTAAAATGATTAATCTT
ATTACTGGAGGCCTCAAATTGCTTTGA


>Contig1451.1.g14(protein)
MSEVLVWVILGVIIGLFVDIVRKMFKKDQQKKKVRSKKLKSKNEEEDEMVEESDWVDDDS
DEDQVNSADGSKRIKDEVLFESYPIQDVKMVLIVREDLKMGKGKIGAQCGHATLGAYKQC
EKYSKDSDYWKKVLNNWSWEGQKKICVKVNSEQELLDLQSKAKEKAIPAYVVADAGLTQI
KEGSLTVCGLGPAPTKMINLITGGLKLL