Identifiers and Description

Gene Model Identifier

Contig10721.0.g15

Standard Name

PTH2L

Aliases

Contig10721_0_g15

Description

Peptidyl-tRNA hydrolase PTH2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01981 ) Peptidyl-tRNA hydrolase PTH2
  • ( pfam14253 ) Bacteriophage abortive infection AbiH

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10721.0.g15(coding)
ATGTCATCAAAACTTAAGAAATCAGAGTCCAAGTCTGCTAAGAACAAAGACACCAAGCCT
TAAGCACAAGTCCCATCCTCTCCTTCTTCTCTGATCTAACAACGAATGACCCAGACCAGG
TCTATGACCATTCATTAGCCTATACCTATCGGGAAATCTTATAAAGCCCAGGATTTCTAC
AAATATATGCAAAAACGCGACGCTAAGATGCAAAGAATCATCGAAAAAGAGGTTAGAGAT
TAGTTCCTAGACTAAGTGAGGGAAGACGCAGTGAGGTGGGCAGCTGTAGACAAGAAAGAT
GCCAGACATATGAAGAGATAAAATGAAAAAGTAGCTGAAAAGGAGCAATATGACAAGATA
AAACAAGAAAAACAAGAAATAATTAAGCAAGACTAAGAGAATATGGAAAAGTGGTCTAAA
AACAGGCAACCCAAGGCCAAAGAAAGCAAAGCAAATCAGGAAAATCTAGAAGAGACTTAT
GATAAATAAGAATAGAAAGAAACTGCTAATGATTACTTACAAAATGCATAAGATAATACC
GATGTTGAAATGAGTCAGTCAAACGTTCAATTGTGA


>Contig10721.0.g15(protein)
MSSKLKKSESKSAKNKDTKPQAQVPSSPSSLIQQRMTQTRSMTIHQPIPIGKSYKAQDFY
KYMQKRDAKMQRIIEKEVRDQFLDQVREDAVRWAAVDKKDARHMKRQNEKVAEKEQYDKI
KQEKQEIIKQDQENMEKWSKNRQPKAKESKANQENLEETYDKQEQKETANDYLQNAQDNT
DVEMSQSNVQL