Identifiers and Description

Gene Model Identifier

Contig18280.0.g79

Standard Name

PTH1

Aliases

Contig18280_0_g79

Description

Peptidyl-tRNA hydrolase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003138401.000361553249356e-16peptidyl-tRNA hydrolase, putat
ive

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18280.0.g79(coding)
ATGAACGCTTTACTTTTACAACCAAAAACATACATGAATATAATTGGGGTTAATGTGTCT
GCTGCTCTGAAAAGTTTTTAAGTTGAAAAACAAAATATTATAATACTTCATGATGATTTG
GAGAGAAAACTTGGCAATTTTAGAGTTGTTAAAGGCACAAGTTTTAATTTGGGAGGATTT
AAAGATTTCACTAGATTTGGAATTGGCATAGGAAGGCCAGAACAAAGAGATGAGAACACA
GTTGCAAATTATGTTCTCTCAAATTTTAGCAAAGATGAAATCGATTAACTTGAGAAAGAA
GTCTTCAGTAAAATATATCAAAGAATCATTACAAATAAATTAGAAGCTGATAAAATTTGA


>Contig18280.0.g79(protein)
MNALLLQPKTYMNIIGVNVSAALKSFQVEKQNIIILHDDLERKLGNFRVVKGTSFNLGGF
KDFTRFGIGIGRPEQRDENTVANYVLSNFSKDEIDQLEKEVFSKIYQRIITNKLEADKI