Identifiers and Description

Gene Model Identifier

Contig21187.0.g64

Standard Name

PTCD1b

Aliases

Contig21187_0_g64

Description

PPR repeat family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008379708.003693242657371e-87hypothetical protein
SGDYLR067C0.0000029996948234116693PET309 SGDID:S000004057, Chr X
II from 270710-267813, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21187.0.g64(coding)
ATGAACTCTTATCTAACTAATGACACCTCGTGTCACTCTACATACAATGCTGTTCCAAAA
CAAAGTTTGTCAACTATCGAGAGCTACTTGAAGAAATCAATGTTTATATTGAAACTACAC
TTGTACTTGAGGGTTTAAAACACTTTAACTGCTACATCTGAACAAACCTCAACTGAGATC
TGCGACAATTTTTAAGCTGAACATGATTAATTAAAAATGGAAAATCTTGATTCTAATGTG
AAAAGTCTCTTAAAGGAAAATTGTGTAGATATTGCTATTAAAAGCTGTGCATAAAGAGCA
ATAACTTCTTAGCAAAGCACTCTAGAGTCTAACATTCTAAGCTATGAGGAAGATCTAGAA
ATGTCTCAAATGCTCTACTATTATGTCAGAATGTGCCAAAGACTCAAGAATATTTCTTAA
ACAAATACATCTGAGAGTTAAGATTAAAATCAAGTTGGTTTCGAGTCTAAACTTTCCCTT
TCAAGCAAAATCCTTCAAATCTATGGAGATAAGGATATAGACATTTCAGCGGTCACCAGT
TTAATGGAAGCTCTCTTGAACTACAGGAAAAATGGTTAATTTTACGATACTTACTAAGAA
GTAGTAACAAGACTGACAAGAGATGATTGCATCAACAATCAGAAAGATCTCCACAACTTC
TTTGGTGTGACTGCAAAAGCTATCATGCTCACTAAGAGTGCACATAAGGGCGTGCTTATG
ATTAAGCTTATGTCTGAACTTAATATTCCAGTGCTTGTTGAGTCACATCTTAATCCAGTA
ATCGAGGGATGCTTCAGGAATGGAAAACAAAATCTAGTTCAGGAAGCTGTTCACAATGCT
AAGCGCACAGATTTCCTCGCTTCTTCAACTCTCAAGATTTTTGTCAAATATTACTCAAGA
CTCAATCAAACTCAAACTGCCTTGTAGTATTTCCATTAATTACAACAGACATCCTAAGCT
TAGAATGATCCAACATACTACCAAACTGTCAATCAAATGCTAGATTCTCTTCTTAAAGCT
GAACTTTTTGAGGAAGCAGAGTAAATTTACAACAAGGTGTTCACTTTAAGTAAAGATTAA
CCTAATTGCATGGATATGATGACATTCAGTTGTATGATCAAGGGGTATTGCAGAGCTTAA
AGACTTCCATAAGCTCTGAATGTACTTTCAATCATGAAAGAAAGAGGCATAAAACCAGAT
GAAGTTTTGTACAACTCAATTATTGATGGATGTTCAAAGAACAATTAAATTGCCAAGGCT
TTCTTACTCTACGATGAAATGCTTGGAGAGGGTGTAACCCCAACAACTATCACCTTCAAC
TCTTTGATTGATTGCTGTGTAAGATCTGGAAACCAAGACCAAGCCTGGAGAGTTCTTGAG
TAAATGAAAGAAAAGCAAGTGAAGCCTGATAATTACACATATTCTACTTTGTTCAAGGGC
ATTAAAAGTGAGAATCAGAGATAAGATCTTGAGAAAGCTTTTGTTCTCTACAACTAACTT
CAAAATTCAAATGATTTCACTCCTGATGAGATACTGTTTAATGTGCTGCTTGATGCATGT
ATCAACTGTAAATAGCTTGATAGAGCAGTTGAACTATTCAAGTAGTTGAAGCCTCAAAGT
TAACCACAGATACAAGTTTCTAACACAGACGATGCAGATAACTCCCTATCTCTAGAAGAC
TCACCTGATTCTGCTAAGAACGCTCCCGCTGTAGTAAACTCCTCCAATCATCACTTCATG
AGACCTGATGAAATCTCCTTCAACACAATAATCAAAGGTTGTGCACAAGAAAAGAAGCTC
TAATTAGCTTTTGAAATGTTCAATCTCATGAAGATGCAATGTCTAAAGCCCAACGATGTT
ACTTACAACTCTTTAATCGATGCTTGTGTGAGATGCAACAGACTTAACAGTGCTTGGCAA
TTACTCAGTGAAATGCAACAAAATAATATCGTGCCAGATAATTTTACATACAGTACACTT
ATCAAGGGTATCAGAGCCGAAAATCAAAGTTAAAACGGCATTTCAAACCCTATGGACTTA
GAGAAAGCTTTCGCTTTACTAGAGCAAATGAAATAGAGCAATGGAGGTGTAAAACCTGAT
GAAATCCTTTACAACTGCTTAATTGATGCTTGCGTGAGATTCCATGATGTCAACAGAGCA
GTCGCTGTATTCTAAGAAATGCAATTCAGCAATATCAAGCCAAGTTCTGTCACTTATGGC
ATTCTTATCAAAGCCTATGGATCAGCCAACTAGCTTGACAATGCTTTCTTTGTATTCAAG
AAAATGAAGGATAACTGTTTAATCCCTAACTCTGTAACATACGGTTGTCTGATTGACGCA
TGTGTGAAAAATAATCAAATCGAGAGAGCAATGGAAGTGTTCGAAACCATGAAGAGAGAT
GGTGTTCAACTAAATACAATCATTTTTACTACTTTGATCAAGGGCTTTGCTAAGAGTTTC
AAGCTTGACTAAGCATTAGAGGTTTATCAAATCATGAAGATGGATGATAAAATTAAACCA
AACAATGTTACATTCAATTCTTTAATTGATTGCTGTATAAGATGTAACTCAATAAAGAAA
GCAATGGAAATATTTGAGGAGATGAAACAGCCAATTTCTCACACAAAGCCAGACTTGATC
ACTTATTCAACTATGATAAAGGGTTTCTGCAGAGAGAAGAACATCTAGCAAGCACTCATT
ATGCTCAATGACATGGAAAAGAACAACATAATGGCAGATGAGGTACTCTACAACTCACTG
CTTGACGGCTGCTGTAAAGCCAATGAGATTGAAATGGCATTGAAAGTGTACAAGAATATG
GAAATTCTCAAGATTAAGCCAAGCAATGTAACTTACAGCATTCTTATTAAGATTTATGGC
AAGTAGAGAAATCTTCCTAAGGCACTTGGTGTACTGGAGGAAATGAAAAAAGATGGCATC
AGACCTGGCCTTATTGTATACACTTGTTTGCTTCAAACTTGCATTAAATCAAGATAATTG
AAGACAGCTGAACAGCTTTTCCATGACATGAGAATTCAAGGAATTAGAGGTGACTAACTT
ACTTATTAAACCATGATTAATGGATGCCTCTATTCTCAAAAGTTTGATTCAATCCTCATA
CTTCTTAAGGACGCTTCAGACTCGAAAGTTTAATTGCCTCATGAGTTGTCTCAAAACATT
CTTACTGAGTTAAATAAATGGAACACAGACAATCATTAAATGAAGCAAGAGATTACTCAA
CATGTCTTGGTGTATCTTGACCAGAAAGAAAATTACTCTTTTAACCAGAACAATTTCTAG
AAACATTTCAATCATCAAAATAACAGCTACAATCATGGCTTTGGTAGAAATCAAAACAAG
ACTTTCAATAATGGCATGACAAATCAATCCTTCAATACCAATTAGATGCTTAGTAGTGTT
AGTAAAAACCTAAATTCAGCTGATTCAGATGAATTTGAGATTAAGTCAGGCCAAGTAGGC
TCTAGAAAAGGCTTCTTCAATTCATCAAGGCAAAACAAAACTGAGGATCAACTTCCAGAC
TAAAGTCCCCAAGTATCCGATTTTACAACACACGATTAGCCAACTAAACCTGCTTTCTAG
TAATCAATTGATTAATCATTAGCCAATGACCAACTGAAAACAGCTATTTCAAATTAAGAT
GCATCTAAGCTCAGTTTGACATCTCATACTACCAATCAATCATCATAATCTCATGTTAAA
GTAAATGATAGCACTTATTAGACTCATAACACTCACAGACAAGTCCATAGTAACCAAAAC
AGCCATTATTAGCAAAACAGCACAAACTCTGGCAAGAGTTATAGTAAACATTAAGACTAC
AGCTATGGAAAGTAAAACAGCTCTAGTTACTACCCAGAAGCAAGCTATGACGAATACAGT
GGTTATGCAAAGAATTTTAACAATCAAAACAGCAGAAACAGTGGTAACTATCAAAACAAC
AGCTATAACAACTAAAGTTAAGGAGGTATGCAACAACCAAACACTCAGTCGGTCTTTGTT
AATCATCAAAAGAACAATCAATACAGAGGAGGTAACACCAGCAACAACTACAATAGGTAT
GAGAACAATGCTAATGGCTATGAAAACAATTAATAATAGTAATAGTACTATGACAAAGAG
AACTACAACCCAAACCCTAACTACTACAAGAATGGTAAGATTACTGGAGGCAACCAAATC
TATCACAAAAACTAACATCATGGTTATGGTCAATCTCAAGGCTACAATCAAGGATATTAC
TGA


>Contig21187.0.g64(protein)
MNSYLTNDTSCHSTYNAVPKQSLSTIESYLKKSMFILKLHLYLRVQNTLTATSEQTSTEI
CDNFQAEHDQLKMENLDSNVKSLLKENCVDIAIKSCAQRAITSQQSTLESNILSYEEDLE
MSQMLYYYVRMCQRLKNISQTNTSESQDQNQVGFESKLSLSSKILQIYGDKDIDISAVTS
LMEALLNYRKNGQFYDTYQEVVTRLTRDDCINNQKDLHNFFGVTAKAIMLTKSAHKGVLM
IKLMSELNIPVLVESHLNPVIEGCFRNGKQNLVQEAVHNAKRTDFLASSTLKIFVKYYSR
LNQTQTALQYFHQLQQTSQAQNDPTYYQTVNQMLDSLLKAELFEEAEQIYNKVFTLSKDQ
PNCMDMMTFSCMIKGYCRAQRLPQALNVLSIMKERGIKPDEVLYNSIIDGCSKNNQIAKA
FLLYDEMLGEGVTPTTITFNSLIDCCVRSGNQDQAWRVLEQMKEKQVKPDNYTYSTLFKG
IKSENQRQDLEKAFVLYNQLQNSNDFTPDEILFNVLLDACINCKQLDRAVELFKQLKPQS
QPQIQVSNTDDADNSLSLEDSPDSAKNAPAVVNSSNHHFMRPDEISFNTIIKGCAQEKKL
QLAFEMFNLMKMQCLKPNDVTYNSLIDACVRCNRLNSAWQLLSEMQQNNIVPDNFTYSTL
IKGIRAENQSQNGISNPMDLEKAFALLEQMKQSNGGVKPDEILYNCLIDACVRFHDVNRA
VAVFQEMQFSNIKPSSVTYGILIKAYGSANQLDNAFFVFKKMKDNCLIPNSVTYGCLIDA
CVKNNQIERAMEVFETMKRDGVQLNTIIFTTLIKGFAKSFKLDQALEVYQIMKMDDKIKP
NNVTFNSLIDCCIRCNSIKKAMEIFEEMKQPISHTKPDLITYSTMIKGFCREKNIQQALI
MLNDMEKNNIMADEVLYNSLLDGCCKANEIEMALKVYKNMEILKIKPSNVTYSILIKIYG
KQRNLPKALGVLEEMKKDGIRPGLIVYTCLLQTCIKSRQLKTAEQLFHDMRIQGIRGDQL
TYQTMINGCLYSQKFDSILILLKDASDSKVQLPHELSQNILTELNKWNTDNHQMKQEITQ
HVLVYLDQKENYSFNQNNFQKHFNHQNNSYNHGFGRNQNKTFNNGMTNQSFNTNQMLSSV
SKNLNSADSDEFEIKSGQVGSRKGFFNSSRQNKTEDQLPDQSPQVSDFTTHDQPTKPAFQ
QSIDQSLANDQLKTAISNQDASKLSLTSHTTNQSSQSHVKVNDSTYQTHNTHRQVHSNQN
SHYQQNSTNSGKSYSKHQDYSYGKQNSSSYYPEASYDEYSGYAKNFNNQNSRNSGNYQNN
SYNNQSQGGMQQPNTQSVFVNHQKNNQYRGGNTSNNYNRYENNANGYENNQQQQQYYDKE
NYNPNPNYYKNGKITGGNQIYHKNQHHGYGQSQGYNQGYY