Identifiers and Description

Gene Model Identifier

Contig13288.0.g36

Standard Name

PTCD1a

Aliases

Contig13288_0_g36

Description

PPR repeat family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000592504.997699094967085e-82hypothetical protein
SGDYLR067C0.000019995566179747357PET309 SGDID:S000004057, Chr X
II from 270710-267813, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13288.0.g36(coding)
ATGATTATAGAGAAGGCTCCAGCAATTGCACCTATGATCAAGCAATAAATCAAAACCAGA
TTCCCTGAGTTTGATGATAAAACACCAATGAATTTGAATGATCCAACATTTGCACCAACA
CTTGCTCCCAATGAGTATCTCAAGCATATGGATACCTCTTTTGAATCATTTTTTTACCAA
AGAGATTACACTAAAGGAAACTTCAACTTCTATCTATAGGTATTATCGCAATAGTATAAA
CCTGAATAAGCTCTGGATGCATTTAGAAAAATGGAAACCATGGGAATATAACCTGATGAT
GAATCATATAATCATTTGATGACAGCTTATGCAAGAATGAAAGATGTAGAAATGGTTGAA
AAATTAAATAAGGAAGCAGTATTCAAATATAAATTACCACCAAGTGCCCAGAGATATAAT
GCTATAATATTAGCACTTGCAAAATCCAATAATGCATAGGATGCAGAGAAAGTATTAAAC
GAAATGAAAAGAGAGGGTTTAAAACCTGACTGCGTTTCTTACACAACAGTCATTGATGCA
TATAAGAGACAAAGAAATCTTGATAAGTGCTGGGAATTATTTGATCTCTACCATACTATT
GAATCAGAGGGAAGAGGAGCTGATGAGTTCTTAATGAGTTACATGATTAGACTATGCGCA
GGAAGTCATGATGCTGAAAAAGCTATCAGATTATTTAATCAACTTGAAGGAACTGGATTT
ATTAAGCATGCTATACCTTACAATTCAATCATTTTTGCTCTGGCATCTACCTATAGATAT
GCTGAGAAAGCTTTGGAATATTGGCATAAGATGCATGTTGAAAACATCCAACCAGATAGA
CACACCTTCGTTGCTATCTTAAAAGCCTGTTCTTAACTAGGAGACACAAAGACAGCTTAC
GATATTTTGCAAGAAATGAAGTAAAAAGGTTTCCCAATGACTGAATATGTGTACAACGAG
CTTATAAGAGTTTATGCCAATGCTTGCAGGGAGCCAGATATCAAGGAGAGTCATATTGAT
ATGTACATCAAGGATTGCTGGGAACTCATGGATAACATGAAGAAAGATAATGTAGAACCT
AACATCCATATTCTTAATTCATTAGTTCATGTCTATGCTAACTCACTTAAAACACCTGAA
CTTGAGAATAAAGTGCTGCCACTCTATGAGAAATATAAAATTAAGCATGATCTGTTCACC
TACCAATATTTGATAAGAGCTTACATGAACGTAAGAGAAAATGACACAATAATGCAGCTT
TATGATAGAATGACTCAAAAAGACCACTTTAAGCCAAATTAAATGATCTTAGACATGACC
CTAGAAACCTCCCTACGCCTAAAGAACTCTGAAAGAATAGGTGATCTTTTGTAAAAATAT
GTGGATACAAATAAAAAACCAGCAAATTACCTGCTAAATCACATAAGTTAAGTGCAGGAA
CTACCGGATAGAATATATTTATTGATGAAAGACAACTGGGGTGAAAAAGGTTACATTAAT
AAAGATGTCAGGCAGTTCAGAAAACCCACATTCAGAGAAAATCATGCGGATAAGAAAATG
CCCAAAACATAAAATTACAAGAGAATCAGGCCAAGAAAATAGAGAAAGAGAAACTTGGGA
CATAATGTCAGAAAGCAAGTTGGATTTGGAATGTGA


>Contig13288.0.g36(protein)
MIIEKAPAIAPMIKQQIKTRFPEFDDKTPMNLNDPTFAPTLAPNEYLKHMDTSFESFFYQ
RDYTKGNFNFYLQVLSQQYKPEQALDAFRKMETMGIQPDDESYNHLMTAYARMKDVEMVE
KLNKEAVFKYKLPPSAQRYNAIILALAKSNNAQDAEKVLNEMKREGLKPDCVSYTTVIDA
YKRQRNLDKCWELFDLYHTIESEGRGADEFLMSYMIRLCAGSHDAEKAIRLFNQLEGTGF
IKHAIPYNSIIFALASTYRYAEKALEYWHKMHVENIQPDRHTFVAILKACSQLGDTKTAY
DILQEMKQKGFPMTEYVYNELIRVYANACREPDIKESHIDMYIKDCWELMDNMKKDNVEP
NIHILNSLVHVYANSLKTPELENKVLPLYEKYKIKHDLFTYQYLIRAYMNVRENDTIMQL
YDRMTQKDHFKPNQMILDMTLETSLRLKNSERIGDLLQKYVDTNKKPANYLLNHISQVQE
LPDRIYLLMKDNWGEKGYINKDVRQFRKPTFRENHADKKMPKTQNYKRIRPRKQRKRNLG
HNVRKQVGFGM