Identifiers and Description

Gene Model Identifier

Contig18594.0.g7

Standard Name

PSY4

Aliases

Contig18594_0_g7

Description

PPP4R2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004753290.000030009396760408108hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18594.0.g7(coding)
ATGGCAGAAAATTTAGAGGAACTACTTACAGATACTCGTAATTTTACTATTGAAGATTTC
AACAAGCATGAAGATATGTATGATTCAATAATTGCGCAAATCGCTAGAAAATATCCAGTG
AATCTTAAAACTTAAAACAGCTTTTTTGTATAAGTTGATGGATAAGAAATAGAAATTAGT
TGGGTGCAAAGCTTAAAACAAATAGTTAAACTTAAGATTTTAAAGAGAATCGATGAGTAC
TATCCAGACGTTTTTGATCAAGATGATATCGATGTTAATAATTAGGACTCAAAATTAGAA
GAAAAAGATGAAAACGGAAACTTAGACAGTAATTTAAACAGTGCTAATGGAAGCGACACC
TCTGGAATTAATACATCATCTGCCTATAGAAAAGTCAAAAAATCTAAGTAATAGACAATT
GATGAGGAATTCACCTTCCCTGAGATGCATAGATCCAATAAGAACATTTTAGAAACTCTT
AGTGTTTACTACGATCAATATCAAGTGATGCCTCCCTTTACTTTACAAAGACTCTGTGAA
TTGCTCTCTCATGAAATCGGGACTAGATCACATCCATACTCTCAAAAACACAAATTTCTC
TTCAATGTTGAAAAGCTAATTAATGTGCAGTGGCAAAATGACCCATTAATCACTAAACCC
TTGTAGTGA


>Contig18594.0.g7(protein)
MAENLEELLTDTRNFTIEDFNKHEDMYDSIIAQIARKYPVNLKTQNSFFVQVDGQEIEIS
WVQSLKQIVKLKILKRIDEYYPDVFDQDDIDVNNQDSKLEEKDENGNLDSNLNSANGSDT
SGINTSSAYRKVKKSKQQTIDEEFTFPEMHRSNKNILETLSVYYDQYQVMPPFTLQRLCE
LLSHEIGTRSHPYSQKHKFLFNVEKLINVQWQNDPLITKPLQ