Identifiers and Description

Gene Model Identifier

Contig3771.0.g81

Standard Name

PSR

Aliases

Contig3771_0_g81

Description

Cupin-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007805203.000935899181433e-99jmjC domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3771.0.g81(coding)
ATGGAAAAAATTCAATAATTACAGGGTGCGTCAACTACTAAGCATCTAAAATCTAAATCA
GAACAAATTCAAAATTTATCATAATAACAAGATGGTCCTAGCACAGATGATACTCTAAAG
TCCTAAGGATCAAATAGTGAAAAACAAGCTTTAAGTAAAAATTCTTCATCAAATTCATCT
GATAATATAAGCGATAAAGAATATTGGAACTCCCTAAAAGCTCTAGCACTATAATAAGAA
GTTGACAATGCATAAATTGACTATGTGAAAAACGTTTTGGGAATTAAAGATAATGAGGGA
TTAATAAATGGTCGAATGAGTGATAGCCTAATCGAGAAGATAAATGCAGTTAAACTCAAG
CATAGGACTAGTTTGTACTTAGATGAGTGGTGTGAAGATGGCTACTATAAAAAATAAAAT
GAAGTTTGTGATAAAATATTGAAAGGGGAGGACCCATCATTCAAGGACACTATTGAACGA
GTTCATGTTGATTCAATAACTGTCGAGGAATTTATTGAGAAATATGAGAAGGGTAGTTTT
CCAGTAATTATTTAAGGTGTAGTTGATAAATGGCCTGCTAAAGAAGAATGGAAAGTTAAA
AATTTGCTTCAGAAATTTCCAACATCTATGTTTAAAATAGGTGAGAGTGATTCTGGAAGA
AAGCTAAAAGTTACTTTGAAAGAGTATATTGAGTATATGATTTACAATAGAGATGATAGT
CCATTATATTTATTCGAGAGCTCACTTGAGGATCATAAGGAAGCCAAAGTAATGATGAAG
GACTACAAGGTGCCAAAGTTCTTCAGATAAAATCTTTTTACTGTCTTAAAAGAAGATGAC
ATGCCTCCACATAGATGGTTTTTGATAGGGCCAAAAAGATCAGGCTCAGAAATACATTAA
GATCCCTTAAATACATCCGCTTGGAATGCAAGTGTTATGGGGCATAAGAGATGGCTTTTA
ATTGCTCCTGGGCCAGATATTACTAAGAAGCTGGTTAGAGGAAGACACCTAATTACAAAA
GATGAAGATGACGAAGCTATATAATACTTTGATTTCATACTACCCAGACTAAAGCATAAA
GAAGGACATAGACTAAAAATTATTGAAGGAATTCAACAACCTGGAGAATGTATTTTTGTT
CCTGGTCAATGGTGGCATGCGGTACTGAATTTAGATGACACAATTGCCATAACTCAAAAT
TATTGTAATCATGGGAACTTCGATCGAGTATGGATTGATACTAGATAGAGTCGCAAAAAA
CTCTCATGCAAATGGTTGAAACTTTTAAAGAAACATGAGCCAAAATTCTACAAAAGAGCT
CTCGACTTAAATACAAGAGATGGATTTGTAATGTGGGATGAAAGATCAGACAAAGATAAA
AAACGAAAAAAGAGAAATAGATCTGGAAGTAGTAGCTCCAGCAGTAGTTCGAGCAGCTCT
TCATCTTCAAGTTCAAGTTCAGCTAGTAGTATCAGCTCAGCGAAATCCTCCTCTCAAAGA
TCCAGTGCTAACGATAAAAACAGTAATTAGAGCAGGAAATCATTAAAATCGTCTGACCGA
TCTCAAGAGAATACAAATAAATTGAAAAATTAAAACACAAGCAGAAATTCTTCAAATTAA
AGCCATTCTTCTGACAGTGAAAAATCTATAAGAAAGAGAAGCAGAAGTAGGGAAAAGGAT
TTTAATTAAAGATTGAATAAGTCTATCTGA


>Contig3771.0.g81(protein)
MEKIQQLQGASTTKHLKSKSEQIQNLSQQQDGPSTDDTLKSQGSNSEKQALSKNSSSNSS
DNISDKEYWNSLKALALQQEVDNAQIDYVKNVLGIKDNEGLINGRMSDSLIEKINAVKLK
HRTSLYLDEWCEDGYYKKQNEVCDKILKGEDPSFKDTIERVHVDSITVEEFIEKYEKGSF
PVIIQGVVDKWPAKEEWKVKNLLQKFPTSMFKIGESDSGRKLKVTLKEYIEYMIYNRDDS
PLYLFESSLEDHKEAKVMMKDYKVPKFFRQNLFTVLKEDDMPPHRWFLIGPKRSGSEIHQ
DPLNTSAWNASVMGHKRWLLIAPGPDITKKLVRGRHLITKDEDDEAIQYFDFILPRLKHK
EGHRLKIIEGIQQPGECIFVPGQWWHAVLNLDDTIAITQNYCNHGNFDRVWIDTRQSRKK
LSCKWLKLLKKHEPKFYKRALDLNTRDGFVMWDERSDKDKKRKKRNRSGSSSSSSSSSSS
SSSSSSSASSISSAKSSSQRSSANDKNSNQSRKSLKSSDRSQENTNKLKNQNTSRNSSNQ
SHSSDSEKSIRKRSRSREKDFNQRLNKSI