Identifiers and Description

Gene Model Identifier

Contig12898.0.g105

Standard Name

PSPb

Aliases

Contig12898_0_g105

Description

Endoribonuclease L-PSP

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009269902.998800627344286e-26endoribonuclease L-PSP, putati
ve family protein
SGDYER057C7.003160085026828e-16HMF1 SGDID:S000000859, Chr V f
rom 271126-270737, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12898.0.g105(coding)
ATGAAGTTGCAGCAATTCACATCTCTCTCATCTACCTCTTTCTCGCAGCTATACTTCAAC
TAATTTGCTCATTCAAGAGCTATGATCAGTTTAATGAATTAAAGATAAATCATCACTGTA
AATGCTCATTCTATGAGAATGCGTTAGTTCTCAACATTTTCTAGAGTTCAGGGTAATTCA
GTAAAGATTTCCAGTCATTCCCCTCCTAAGCTCAGAATACCAGTTAGCAACGACGGCAAA
TAAGCTTACGATTTTAGTYTAATTGATTCTGAAACTGTGGCACATTTTGAACAAAAAGTC
AAAGAGCAGACTGGACTTAAGAGCTTCACACTTGATAAGTAAGCAGATAAAGAGTCAAAG
ATAGGAGATGTGATAAAAACTAAATTTTAGATGGAGGTTAATTCAAAGCCATATGATGTC
TATCCACTTTTTCAAACTATGGTTGATAAGAACTACTCTGCTTAATCGCATTAACTTATT
GATCAAGTTTTCGAGGGTAAATCTATTCCAATCTCAAGAAGAATTATACTCTATCACTAC
TTCGATTAAATGCTTAAAGCCATGTCAAAGCAAATAAATTAAAAATAACTTACTGAACAG
GAAGTTAATCAAGCAATTCAAAGAGGTTTAGATGAATATGTTAAAACTTACAAATCTCAA
ATTTACGAAAGACCATCTTAACAACTTGAGCTAGCTTAACAAGAACTTGCATTTTTAAAA
GCTAAACAATCACAATTAGAAAAGAGGGCAAAGAGTCATGCAAGTAAAGTTTTATATGGT
TGTTTGGCTATGGCTATGACTTAACTTACTGGCATGGGTTACTTGATTTTTGTGCATCTC
TCTTGGGAAGACATGGAACCTGTAACTTATATGGTCTCTGCTTTCTATGCAATGATTGGA
GCTCTGTACTACGTAATTTACAAGGGGGATTTCGAGATGGCCTCTGCTTACGATTTATTC
CAAAAAAGGAAGTATGATGGACTCGTGAAAAAAGAGAACTTTGATGATGAAAAAATTGAA
TTCCTAGAAACTTACATCAACGAGCTACAGGAACAACTAGGCATCTTGCAAACTGAAGAT
AATCAATAAAGAGAAAAGAGTCAGGGAGACATTATGGTAGATCTGAGTATCAATATTAAC
AGAGGTAGTTTCAAACTTAATTTTACTCTTATAAAAATTGACTTCGGGAGACATAATGCA
CTAGTCAGAGCAGGGGTTTTAGGGGGATTAGCTTCATTGCTTCTTTATCAAGGATTTATC
TATGCATAGAAATAATATTCACAAAATATTGAAGAGAACAAATCTCTTTCTGATGATTTA
AAAGTCGCATCTAAGGTGTAGACATTGAAATCTAAAGAATTCTTAGACATTCCGTTGCCC
TTTTCTCTTGGAAAATATTTTCATTTGATGCCAAAAAGCATGCAATACACATTTTGTTCT
GGAATGATGTCAAACAATATCAAATCACCCACTTTTGAGTTTAATGAAGAAGCCCATGGT
AATGTTGAAGTCTAAACAAGGACAACAATTTAAAACATAAAGTAACTCCTTCAAGATTTG
ACTGATTAAAAAATTGAGCTTCCAGCTATAGTTTATGTGGGGGTAGTCAAGTTGCCCCTC
CCACATGGTCTGATTGAAATTGAATGTGAAACTGTAAAACCATTAAATCCTAAGTGTTAA
AAACACTTAATAATTATTATTATTTAACTTAATTAAACAGGCATTATGGACAAGATAAAG
TCAGAGCATGTTATTGCAGGAGTCATTGGTGGTGTCACTTCTTTGGCCTTAGCTTTCTTT
GCAAGAAAGATGATGTTCAGACACAAAAGAGGGGGCATGAGAAAGTTCTTCCAACAACCA
GAAGTTATTACTATGCAATCTGATAATATGCCAGCTGCTATAGGACCATACACCAAGGGT
AAATTGATCAAGCTCCAAGACGGCAGCATGATGGCCTACTCCTCAGGATAACTCGGCCTA
GACCCCAAGACCAGCGAATTGGTCTCAGATGATGTTGCTGCTCAAGCTGAGCAAGTCATC
CTCAATCTTAAATCACTTGCTGAGGACAACGGTATGACTCTTGAGGATACTGTGAAGAAC
GTTGTGTACTTGACAGATATGGGTGACTTTGGTGCTGTTAATGAAGTTTACAAGAAGTAC
TACAAAGGTGAGTACCCTGCTCGTACCTGCATCGCCATCAAGGCTCTCCCCAAGGGTGGT
CTCGTTGAAATTGAATCTGTCTTTTTCAAGCCAAGAGCCCCAATTGAGAAGAGAGGCTGC
TGCATGTGA


>Contig12898.0.g105(protein)
MKLQQFTSLSSTSFSQLYFNQFAHSRAMISLMNQRQIITVNAHSMRMRQFSTFSRVQGNS
VKISSHSPPKLRIPVSNDGKQAYDFSXIDSETVAHFEQKVKEQTGLKSFTLDKQADKESK
IGDVIKTKFQMEVNSKPYDVYPLFQTMVDKNYSAQSHQLIDQVFEGKSIPISRRIILYHY
FDQMLKAMSKQINQKQLTEQEVNQAIQRGLDEYVKTYKSQIYERPSQQLELAQQELAFLK
AKQSQLEKRAKSHASKVLYGCLAMAMTQLTGMGYLIFVHLSWEDMEPVTYMVSAFYAMIG
ALYYVIYKGDFEMASAYDLFQKRKYDGLVKKENFDDEKIEFLETYINELQEQLGILQTED
NQQREKSQGDIMVDLSININRGSFKLNFTLIKIDFGRHNALVRAGVLGGLASLLLYQGFI
YAQKQYSQNIEENKSLSDDLKVASKVQTLKSKEFLDIPLPFSLGKYFHLMPKSMQYTFCS
GMMSNNIKSPTFEFNEEAHGNVEVQTRTTIQNIKQLLQDLTDQKIELPAIVYVGVVKLPL
PHGLIEIECETVKPLNPKCQKHLIIIIIQLNQTGIMDKIKSEHVIAGVIGGVTSLALAFF
ARKMMFRHKRGGMRKFFQQPEVITMQSDNMPAAIGPYTKGKLIKLQDGSMMAYSSGQLGL
DPKTSELVSDDVAAQAEQVILNLKSLAEDNGMTLEDTVKNVVYLTDMGDFGAVNEVYKKY
YKGEYPARTCIAIKALPKGGLVEIESVFFKPRAPIEKRGCCM