Identifiers and Description

Gene Model Identifier

Contig14449.0.g106

Standard Name

PSPa

Aliases

Contig14449_0_g106

Description

Endoribonuclease L-PSP

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009269909.99967697349061e-30endoribonuclease L-PSP, putati
ve family protein
SGDYER057C2.999758165421992e-18HMF1 SGDID:S000000859, Chr V f
rom 271126-270737, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14449.0.g106(coding)
ATGGACAAGATAAAGTCAGAGCATGTTATTGCAGGAGTCATAGGTGGTGTCACTTCTTTG
GCTTTAGCTTTCTTTGCAAGAAAGATGATGTTCAGACATAAAAGAGGCGGTATGAGAAAG
TTCTTCCAACAACCAGAAGTTATTACTATGCAATCTGATAATATGCCAGCTGCTATAGGA
CCATACACCAAGGGTAAATTGATCAAGCTCCAAGATGGCAGCATGATGGCCTACTCCTCA
GGATAACTCGGCCTAGACCCCAAGACCAGTGAATTGGTCTCAGATGATGTTGCTGCTCAA
GCTGAGCAAGTCATCCTCAATCTTAAATCACTTGCTGAGGATAACGGTATGACTCTTGAG
GATACTGTGAAGAACGTTGTTTACTTGACAGATATGGGTGACTTTGGTGCTGTTAATGAA
GTTTACAAGAAGTACTACAAAGGTGAGTACCCTGCTCGTACCTGCATCGCCATCAAGGCT
CTCCCCAAGGGTGGTCTCGTTGAAATTGAATCTGTCTTTTTCAAGCCAAGAGCCCCAATT
GAGAAGAGAGGCTGCTGCATGTGA


>Contig14449.0.g106(protein)
MDKIKSEHVIAGVIGGVTSLALAFFARKMMFRHKRGGMRKFFQQPEVITMQSDNMPAAIG
PYTKGKLIKLQDGSMMAYSSGQLGLDPKTSELVSDDVAAQAEQVILNLKSLAEDNGMTLE
DTVKNVVYLTDMGDFGAVNEVYKKYYKGEYPARTCIAIKALPKGGLVEIESVFFKPRAPI
EKRGCCM