Identifiers and Description

Gene Model Identifier

Contig20633.0.2.g104

Standard Name

PSO1b

Aliases

Contig20633_0_2_g104

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006975003.0013534825799953e-36Protein kinase domain containi
ng protein
SGDYMR137C4.001630327199692e-20PSO2 SGDID:S000004745, Chr XII
I from 544963-542978, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20633.0.2.g104(coding)
ATGTGTGCATATAATAGATATTAAGGCTACAATAGATCTAAAACAGTAGAGACCACCACT
TTGAGAGATGACCAGAATCCCCTTAAAATGTTCACTTATGTTAATAATGGTGTGGTAGAG
CCATATAAAGATTTCAAAGTTGACAATTTTTACTCCAATCGCAAGGAGCAGTTTACCTTT
TTCCTCTCTCACATGCATGAAGATCACTTGAGAGGTTTGAGTAAACGTAGTGAATATGGT
AATTATGGAGGCCCCGATGAAGACTGGCAATGGGGAACCATTTACACTTCGCCAAAGTCT
AAGAATATTCTGCTTTTGAGATTTCCAAACCTCAAACCTTATGTGCGAGCATTAGAACTG
TACAAGCAGTACACAATCAAGGACAGGACTGTTATGCTTTATGAAGCAAATCACTGTCCA
GGAGCTGTCATGTTCTTGTTTAAGGGAGCTAAAGGGACAGTGCTGCATACTGGAGACTTC
AGATTTAAGCCCTCTATGATTGACTATTTCACTAATATAAAGATTGACTACTTGTACCTC
GACAACACGTTTGCAACAACCGACGAAGATTTCCCACCTTAAGAAGAGGCTTTTGAGAAA
CTTTACTCAATTATCGAACATAAAAGAGGTGTCGATTAAAACTACTAATTTCATTTGTTT
TGCTATACTCTGGGGAAAGAGGAAGTTTTTCATAATTTAGCTTAACTTTTCAGTACTAAG
ATTATGATGCAGAAAGATAGAATCACGAAGTTAAATGCTATTGGAATGGGTTCTTCGAAG
TTTGTCACTAGAGATGAGTGGTCAAAAGATAAAACAGGAGATTGTTTCATTTAAGTGAAG
GTCATGAAGGATCTTCCGAAAACTAAGGAGGATTGTGACAAAAAGAAAAATGTACATTTT
CTCTGCATGACTGGCTGGAAAAATCAGTATAACATTAATCATCCTAGATTTCATAAAATA
CCTTATTCTTCTCATTCAAGTTATAAAGAATTGGATTAATTCGTTAAATCCTTAAAACCT
GGAAAGCTAGTTTTTACGGTACCTGATCATTCTCCTAAAATGGCCAAGTCTAGATTTAAC
TTCCAGAAAAAGTTGCTCAGCTATACCGACGCTGGAAAAGATATAGAATTTCAACCTATT
ATCTAACAATAAAAATTGAGTTTCAAGTCAGTGACATAAGTTGAAAGAGAGATTAGTGAG
CCAGAGATCATTGAAACTTCTGAATAATAAAATGAAGAGTTTGTTCAAATTAATACTTCA
ACTTTAAAACTAGAAAACACAAATAATTTTGTTACAGTTGATAATAAAACTGTTACAGAA
GAATAGATGATTTCACTTTCAATTGATAAGGAAACCAGTTAAATAAATTCTGTTTAAATT
TCCACTGCTAATCAATAATAATAAGCTAAACAACTTTTAAAATAGCAAATTACAACTGAG
TTTGTCAGATTGAATAATAAAAAGAGAAAATTCAAGGAAATCGATGATTTAAGCTTATTA
TCTGAACCCTCAAATTATCAAAATTTATTAAGTTGTAATAATAATAACGAATCAGACAAT
TTTAAGGATATGTAAACACCTCTAAACAAAAAGCAAGCTCTTAGAGATATTGAAGGTACT
AAATTGCAAACTTAAAACGATTTCGCTTCCTTAAAATCATAACAGAGATAAGTGTAAAAT
CAGGATTATGAACTCAAGCAGGAATATAAAGAGAAGAAGAAGTAATAGAATTTGATGGTC
AAAACTGATATGCTGGTTAATCTTGAAACTAATAAAAGATTGAAGATGAACCCAATAAAT
CCACCATAGTAGACTTAAATTTTTTAAAAGAAGTCAACTTAGAAACAGAACCAATAGCAA
AGCCCATAAAAAGGTATTAAGAATTTCTTTTAAGTGGGAAAAGTACTTACATCTGGGATG
ATAATTCCAAAATCGCAATCTCCTATTAACTTAGAGTTTACTGATACTAAGGATTCATAA
GAAAATAAAAGTGAGGAACAAACGATATAAGTAAGTTAGTGA


>Contig20633.0.2.g104(protein)
MCAYNRYQGYNRSKTVETTTLRDDQNPLKMFTYVNNGVVEPYKDFKVDNFYSNRKEQFTF
FLSHMHEDHLRGLSKRSEYGNYGGPDEDWQWGTIYTSPKSKNILLLRFPNLKPYVRALEL
YKQYTIKDRTVMLYEANHCPGAVMFLFKGAKGTVLHTGDFRFKPSMIDYFTNIKIDYLYL
DNTFATTDEDFPPQEEAFEKLYSIIEHKRGVDQNYQFHLFCYTLGKEEVFHNLAQLFSTK
IMMQKDRITKLNAIGMGSSKFVTRDEWSKDKTGDCFIQVKVMKDLPKTKEDCDKKKNVHF
LCMTGWKNQYNINHPRFHKIPYSSHSSYKELDQFVKSLKPGKLVFTVPDHSPKMAKSRFN
FQKKLLSYTDAGKDIEFQPIIQQQKLSFKSVTQVEREISEPEIIETSEQQNEEFVQINTS
TLKLENTNNFVTVDNKTVTEEQMISLSIDKETSQINSVQISTANQQQQAKQLLKQQITTE
FVRLNNKKRKFKEIDDLSLLSEPSNYQNLLSCNNNNESDNFKDMQTPLNKKQALRDIEGT
KLQTQNDFASLKSQQRQVQNQDYELKQEYKEKKKQQNLMVKTDMLVNLETNKRLKMNPIN
PPQQTQIFQKKSTQKQNQQQSPQKGIKNFFQVGKVLTSGMIIPKSQSPINLEFTDTKDSQ
ENKSEEQTIQVSQ