Identifiers and Description

Gene Model Identifier

Contig13766.0.g88

Standard Name

PSO1a

Aliases

Contig13766_0_g88

Description

DNA repair metallo-beta-lactamase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07522 ) DNA repair metallo-beta-lactamase
  • ( pfam12706 ) Beta-lactamase superfamily domain
  • ( pfam07521 ) RNA-metabolising metallo-beta-lactamase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006975005.0020095550341075e-51Protein kinase domain containi
ng protein
SGDYMR137C0.00000000002000577768187062PSO2 SGDID:S000004745, Chr XII
I from 544963-542978, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13766.0.g88(coding)
ATGGATGAAGAACATTGGCTATATCTAGATGACTCAAAAAAGGAGGGAGTTTCCGTCATG
ATGATGGATGCTTTTCATTGTCCCGGGGCAGTTATGTTCCTATTCCGAGGTAAGATGGGA
ACAGTTTTTCATACCGGTGATTTTCGCTTCTCAGAATAAATGTTCGATAATGAAATACTT
TTCCCGCCATCCAAGAGAAATCCCCAAATGAAACAAATCTCAGTTGATATAGACTACTTG
TTCCTTGACAACACTTTTGCAGACCCTGAGTACGATTTTCCTTCTAGAGAGGAAGCTTAT
AAATCCCTTACAGACACAATAAAATCTCACAAGGATCACAGAATTTTCTTGTTCTCTTAT
AATCTTGGAAAAGAAGAAGTTTTTGTTAACCTTGCTTAAGATTTTGAAACATTAGTTGTT
GTAGATGAAGATAGATTTAGAAAGCTTAGCATTATGGATTTAAGGCCTGACTTGTTCACA
ACTGATGAAAAATAAGGATGGATACACATTAAGTCTATTAGGGAATTGAAGAAGTTTGAC
ATTGAGAAGTGCAATGAAGAAGAACCAACAATTTTCATTATTATGACCGGTTGGAATGAT
AAATACAACAGAAATCTCCCTTACTACTTTAAGGTACCCTACTCCAGTCATTCAAACTAT
AGAGAGATTGAAAGATTTGTAAAAGCTATGATGCCCAAAAATTTGGTTTTTAACGTACCT
GAGAGAGCTGTTTCAGAAAAGAGATTACAATTTTAGCACCATTTGTTGAAAAGCTATGTG
AAAAGAGACAAATAAAACTTGTAAAATCCTGTACTTTCAAATCCAAAGAAAGGCTACGTA
TTGAGCTATAATAGTCAAGCTACATAATCCATTTAAAATACTTTAAAATCAGGTAATTCG
CAATTTAACTAAGGTTTTAAGTCACAATTTCTAGAAGAGCATAAAGATCATAACTAGAGT
AAAGAAGTAGGAGTGTCTTCAGGGTATGATTGTGGAGATAATAATCTTAGTGAAAGGTTT
AATGTGAATAATAAAGAAATGAACAAAAAGAGATTTTTAGAGGCTAATGCTAACATTTTC
AAGTCAAAGTAAAATGGGAATAAACCTAGGGGTGCTAAATTTACAAATAAAGAAATATCT
CTTTCCCTTACTCCATAAGGAGACGAATTTGATAAATTACTGAATGAAAGCTCTGAATTG
TTTGAAAAAGTTGAACATATCCCCCAATCAGACCATGAATTACTCGACAAATCAACTTCT
GCACAATCACTTCGTGGATAATAATTAAGAGAAAAATCAGACCAGAAAATGTAATCTGAT
CAGAAAAAGCATGACCAGGATGATCAAAATGATGAACTACTATTGCACAGTGATGAGGAA
GATAGCCAAGGGGATTAAAGTAAGAAAATTGATCAAATAGCAAAGCGATTATTTGATAAC
TAAAATAATTATGAATAGATGGCTGAGAAAATCCCATCTAATTTGCACAAGAAAAGAAGA
TTCCAAGAGATTGACCATTCTAGTGCACATATAGTGTAGCAAAAGTCACAAATTATCGCT
CAATCCCTTGATAAAAACTTTAATAGTGATTAACTTATTTAGCAAAACCAAAAAAGAATG
AAAATTGAGAATTAATCAAGTGATTTCGGTCCAAAGACTGAAAACAATGGAGCTCAACCA
TAAAAAATAAATTTTCTTAAAACTGACCTAATCACTTAGCTTAGACAATAATATGCTTAA
AACAAGCAAGAGATTCAAAAGTCAAAGAAAGCTGTGTGA


>Contig13766.0.g88(protein)
MDEEHWLYLDDSKKEGVSVMMMDAFHCPGAVMFLFRGKMGTVFHTGDFRFSEQMFDNEIL
FPPSKRNPQMKQISVDIDYLFLDNTFADPEYDFPSREEAYKSLTDTIKSHKDHRIFLFSY
NLGKEEVFVNLAQDFETLVVVDEDRFRKLSIMDLRPDLFTTDEKQGWIHIKSIRELKKFD
IEKCNEEEPTIFIIMTGWNDKYNRNLPYYFKVPYSSHSNYREIERFVKAMMPKNLVFNVP
ERAVSEKRLQFQHHLLKSYVKRDKQNLQNPVLSNPKKGYVLSYNSQATQSIQNTLKSGNS
QFNQGFKSQFLEEHKDHNQSKEVGVSSGYDCGDNNLSERFNVNNKEMNKKRFLEANANIF
KSKQNGNKPRGAKFTNKEISLSLTPQGDEFDKLLNESSELFEKVEHIPQSDHELLDKSTS
AQSLRGQQLREKSDQKMQSDQKKHDQDDQNDELLLHSDEEDSQGDQSKKIDQIAKRLFDN
QNNYEQMAEKIPSNLHKKRRFQEIDHSSAHIVQQKSQIIAQSLDKNFNSDQLIQQNQKRM
KIENQSSDFGPKTENNGAQPQKINFLKTDLITQLRQQYAQNKQEIQKSKKAV