Identifiers and Description

Gene Model Identifier

Contig13605.0.g11

Standard Name

PSMA7

Aliases

Contig13605_0_g11

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL038W3.999413844471248e-84PRE6 SGDID:S000005398, Chr XV
from 255337-256101, Genom...
T. thermophilaTTHERM_001285705.997672135862771e-69Proteasome subunit alpha type
7-like, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13605.0.g11(coding)
ATGCCAACTTACGACAAAGCAATCACTATCTTCGCTCCAGATGGAAATCTCTTCCAAGTC
CAATATGCTTTCGAAGCTGTGAACAGAGGTTCAGCCACTGTTGCAGTGAAGGGTCAAGAC
TGCGTTGTGCTTGCAGTTGAGAAGAAAACAACTGCTGCTCTCCAAGATCCCCACACCATC
AAGAAGATCTTGCAAGTTGACCAACATATCATGATGACATTCGCTGGATTACAAGCTGAT
GCAAGAGTTCTCGTTGATAAAGCAAGAATGGAGTGCCAATCGTTCAGATTCAACTTAGAG
GATGAACCATCTCTAGAGTATATCGCTCGCTTTGTTGCCGAAACTTAATAAAAATATACT
CAAAAGGGTGGAGTGAGACCTTTTGGTATCTCTACTTTCATTATGGGTTTCGAAGGCAAG
GAGCCACACCTCTATCAAACAGAACCTTCAGGAGCTTATTCACTTTGGAAAGCTAATGCC
ATTGGCAGAAATTCAAAGACTCTTCGTGAATATTTGGAAAAAGGCTATAAGGAAGCCATG
AGCAATAATGAAACAATCAGACTTGCAGTAGAAACACTTATGGAAGTTGTTGAGAGCTCA
AAGAACATCGAAATTTGCATCATGACTGGAAACAAACAGTTTTAAACTCTTGATGATGAG
ACAATCGACAAATTCGTCAAGGAAGTTGAGAAGCAAAGAGAAGAGGAAGCTGCAAGCAAG
TAACCAGTGCCAAAGTGA


>Contig13605.0.g11(protein)
MPTYDKAITIFAPDGNLFQVQYAFEAVNRGSATVAVKGQDCVVLAVEKKTTAALQDPHTI
KKILQVDQHIMMTFAGLQADARVLVDKARMECQSFRFNLEDEPSLEYIARFVAETQQKYT
QKGGVRPFGISTFIMGFEGKEPHLYQTEPSGAYSLWKANAIGRNSKTLREYLEKGYKEAM
SNNETIRLAVETLMEVVESSKNIEICIMTGNKQFQTLDDETIDKFVKEVEKQREEEAASK
QPVPK