Identifiers and Description

Gene Model Identifier

Contig13202.0.g53

Standard Name

PSF3

Aliases

Contig13202_0_g53

Description

GINS complex protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL146W0.00003998524687536623PSF3 SGDID:S000005506, Chr XV
from 48864-49448, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13202.0.g53(coding)
ATGGCGGCTCATTTAGCATAGGTATCAACTACTGAAGGACTTTTACAATACTCAGCACTT
GGCAAGGGTTCAAGAGACTACTGGAATATTGATGATATTTTGGCAGAGGAAGAGACTTGC
CCTACTTAATTCGTTTTAGACGCAAAAGGATTAGGTTACTTAGATCATTTGGACTAAATT
AACCCTAATTCAGTCAATGCAAACAGAGCTTCTTCAAGCGCTTAAAACATGCTCATTAAG
CAATAGAAGCTTAGACAGTTGCAAAATGAAGTTTTGAAGGCTGGTTCAAGAGTTGAACTT
CCTTTATGGCTAGCAATAGCTCTAGCTTAAAGAGATATCGTTGACCTTTTACCACCAAGA
TATATGACTTAGCAATACTTCAATACACTTTAAGCAGGTGCAGAAGTCGTATCGATGCGC
TAATAAAGTCCATACATCTACGAAAATGTTAATAAAATATGCGAATATATAGACGAGGAG
AGTAGCAAGAGGGCTATGGAATTATATCAAGCTACATTTGTTGAAAGATTCGCAAAGCTA
GTCATTGATTACTCAAACAATTCAAATTAAACTGAGCAGTTCACAGGAGTGCTTAAAAAG
TTAACAAATTTGGAAAGAGAGCTGTTCGATACTCATAAAAAGCAAAAGATTAGCATTTTT
AATTGGAAAAATAGAATCGTATCTTCTGTAGAAGTCAATTAAGACTTTATTAACTAATAA
AATGGGAGTGAAACAGCAAACATAAAGAGATTCAGAACTATGTGA


>Contig13202.0.g53(protein)
MAAHLAQVSTTEGLLQYSALGKGSRDYWNIDDILAEEETCPTQFVLDAKGLGYLDHLDQI
NPNSVNANRASSSAQNMLIKQQKLRQLQNEVLKAGSRVELPLWLAIALAQRDIVDLLPPR
YMTQQYFNTLQAGAEVVSMRQQSPYIYENVNKICEYIDEESSKRAMELYQATFVERFAKL
VIDYSNNSNQTEQFTGVLKKLTNLERELFDTHKKQKISIFNWKNRIVSSVEVNQDFINQQ
NGSETANIKRFRTM