Identifiers and Description

Gene Model Identifier

Contig10055.0.g99

Standard Name

PSF2

Aliases

Contig10055_0_g99

Description

GINS complex protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010504409.998720540547892e-23Partner of SLD five, PSF2 fami
ly protein
SGDYJL072C0.00000000000009996062864481225PSF2 SGDID:S000003608, Chr X f
rom 305862-305221, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10055.0.g99(coding)
ATGAATTACAGGAATTATACTCCACAAGAGAACGAATTTTTCGCGGAAAATGAACTCATT
CCAATCATCCCTAAATTCAAGGAAGAGTCCTTTTCATTTGTAGGTGGAACTTACGGCCCT
TTCAGACCAGCTAAGCCAGTTGTTGTACCTATATGGCTCGCTATCTATCTCAAATCAAGA
GGCAGATGTCAAGTTTAACTTCCCAAATGGCTAGACTACGATCACTTGAAGAGAGTTAAG
GCAGAAGAAATGGAGCTTAGCATAGATTTCAGCAGTGAGATTCCATACTATTACTATGAA
ATAGCAACTCTACTCTTTAATAATTGCTCTGATGAGTTTTCAATTAATAATGGCTAGGGT
GGTTCATCAGCTACAAGCGGAGTTTAGAGAGTAAAAAGTATTATTGAAGACATTCAAGAA
TTGAGAAGAGAAAAGCTGCTTAGAATGCTTAAAAATATCGATCCTGTCACCCCAGTCAAG
TATCTGGGTACTTGTGGATCTGTGGAGATCAATCAAATTAGACCTTCATTTACAACTGCA
TATAGTATTGCACATCAAATGCAAAATATTGTAGAAAAGAAAAGCGATCCTACAGAAAAT
TAATGA


>Contig10055.0.g99(protein)
MNYRNYTPQENEFFAENELIPIIPKFKEESFSFVGGTYGPFRPAKPVVVPIWLAIYLKSR
GRCQVQLPKWLDYDHLKRVKAEEMELSIDFSSEIPYYYYEIATLLFNNCSDEFSINNGQG
GSSATSGVQRVKSIIEDIQELRREKLLRMLKNIDPVTPVKYLGTCGSVEINQIRPSFTTA
YSIAHQMQNIVEKKSDPTENQ