Identifiers and Description

Gene Model Identifier

Contig8807.0.1.g80

Standard Name

PRPF38B

Aliases

Contig8807_0_1_g80

Description

PRP38 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007051502.0007467515522948e-59EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8807.0.1.g80(coding)
ATGACTGGTAAGAACACAGACTAGCATTTGGATAGAGAAATTCTGGAGAAAAAGTAGCAG
CTTTAAAGTTACTACTCTGAGATAGCGGCAAGTGATCCATATGCTCCTCAAGGTGGAGAT
AATTTCTATGTTGATTAAGCTAGATAAGAAGACGAGGAAAGAGAGAGGAGAGGGGGCAGT
AGATATGGAGGCAGCAACAGCATGAAATACGATCCCAAGTAAATGCTCAAAGAGAAGATG
CAATAATAGTAGGACATGATCAAAGAATCCATGATGACTGAGCAATAAAAAAATGCAAAG
TTGGTTGAAGAGGTATTGACATCGAAAGAGCATGAACAAGAGAAAAAGATTAAAGAGATT
GAACATGAAGTTTTATCTGAGCTTTAAAAGTGTTCATTGCATCCAAAGAACATATTCTAG
AATAAGAACTGTAGACATTGTAAGAAAATCAGAGAGGAATTTGAGGTAAGGAAAAATCAA
AAATTAGAGGAGATTTAAAATAACCAAAAAGGTGAAGTAGCAGGCAACAAAGAGCTTACA
GTTTCAGAAATGATATCTGCAAATGGCCTATTCCCTACAAGTTGTGATTATAAAAATGGA
AATCTTCCAGAAATGATCAGAAACACAATTCTTTCTTGCTAATATTTTAAAGATCTGTAC
AACCTCAAAACATTCAAAGAAGTTATTGAAGAAATCAAAACTCATGTATCCTATACAGAA
CCCTGGATAGTTGGAGCAAACGGAGTACCATCAACTCTTTTTTGTTGTCTGTATAAATTC
ATGCTCATGAGATTGAATGAGAAATAAGTTTAAACTCTCTTGAGATACAAATTAAGCCCT
TATGTCAGAGCGTGTGGAGCTCTCTATGTTAGGTTTTTAAGTCCAAACGACTAACTTTTT
GATAGATTGAGCCCTTATATGCTTGATGAGTAGTCATTTAGTTATTCAATTGAAAAGTCT
CAGAGTTTGACATTTGGAGAGTATGTAGAGAGACTTCTCTCTGAAAAGAATTACTTTTCA
ATTCTTTTACCAAGAATTCCAGTTATATAGTTCAGAGAATTGCAGAAGAAATTACTAACT
ATACCAGAAAAAAGGAAGAGAAAGTAAGATAACTTAGAGAACAGCAATAAATTCAATAAA
GGCTAAATCGTATTTGCTTTAAGCAAGAAAGATCAATCATGGCATAAAGCTAAAATATCT
GGTATTCATTATGAATCTTCTGCCCCAATTTAGAAAAAACCTGTTGAAAACTATGGAATT
GAGGAAGACTTTTTCAATGAAGAAGAAGGCGAAAATTTCGATAATGAGTATGATGAGGAT
GAACAAGATGTGAGAGCTATCAGAAAGCTCTAAGTTATGTTTATTGAGGGCCCATTTACA
AAGGATGAAGAAGTTTAGGAATTCATAGGTTTAGAGGATGTGCTTTTGATCAGCAGAAAC
GAAGAAGGTGGATAGAAACATAGAAAAAGATCACAATCCAATGATAGTTGGGGAGATGAT
TCTGACGCTTAATAATCTAGAAAAGCAGAGAGAAAACGATCTAGATCAAGAGATAGAGAC
GGAGATTTCAAGACACCTTTTGATCGTAATGAAAATCAGGATGATAAACTTATGGAAGAA
GTTTTAAGAAGAGAAAGAGATTAAGCTGCTGCTTCAAGAAAAGAAGATTATTCTAAGAGA
CCAGCAAGTTACAAAAGTGCTCTTAGTTTGGCTTTACCAGTTGGAACTACTAGAAAGAAG
GACTCAGAAAGAAAGAACTCCCCAGAAAGGAAGCTCGTTCATGTTGAAAATCCTGCTGCT
TATAAAGAAGAAAAGAGAGATCCTTCTAAACAGCTTAGTAAAGATGAGCAATTTGAGAGG
ATGAAAAAGATTCAAGAAAAGTATGGAGATGCATCAGCATTAATAAACTTGACTCATGTC
TTTGATTGCTATGAATCTTTTGCAAAAGAATACAAAGACAAACATTTGATAAATGAAGAA
GAATTTGATGACATTTTTTCACCATTACTCAATGACACTTAAATTTATTATAACAAATTG
TAATCGAATGGTAATGCAGATTTTTATGAAGCTTTTGTTGCCCTTTCATTATTCTCAAAA
GGAGAGTTTGATCGTAAAATTAAGGGAATATATTTAGCTTTTGATTAAGATAACAGTGGA
TCTATTGATAGAAAAGAGCTTTTAATGTTCTTATACAATGGAATATTTGGTTTGTGTAAA
TTGTTAGGTCTCCCCATACCAAGAAGGGATGATGTTCAATAATATGCCTACAATATTTTC
AAGATTATAGACATTAACAAAAACGATTGCATAGAGTATTCAGAGTTTGCTTTTTGGATA
AAGGAATCAGATGAAATTTAAGATTTTTTGTTAAAATACACTGGCCAATAAACTTTTGAA
AGAGCTAGAAAAAGATACAAGGGGCTTTTAGATTACTAACAGTAATTATTTGATGAAATA
GCTATTGATTTTATGGGAGAAAAGGTAATTTTAAAAATCTTTATTACATTAAATTAACAG
TACGCTACTATGGTTGAATTGAAATAAGTGTTATTGAAAGCAATGAAATAAATTCAACCA
CATATCTTAGAAAAGCTTTTTCTTATCCTTGATTATGATAATAAAGGAGCAGTGAGCGAA
TTTGAATTTAATACAGTCATGAAACCATGGGCTTCTTTTTCAGCTACCGACATAAATAAT
GATAATGAGTTGGATAGCATGGAGCTCAAAACTCTAATTTGGCTGATTGATGAGGAAGAG
CCACTTGAGAGTAGAGTGTAGAGAGATTTAAAATTAATGGATCGAGATGGATCGGGGACT
ATTGATAGACTTGAGTGGATCCAATTTTTAGCCTCTCCAGATCCTACGACTGGTATTGAG
ATCTTCGATTTTAATTTGAAGAAAGCTTTTGATACTCATGATGCAGATAAAAGTGGATCG
ATTGATCTAGAGGAGTTAGGCGACTTGCTAATGGAAAATTTTGAAGATTTGATCAAAGGG
AAAAGCGATGAAAATAGATAAATTATATCAAAACTGATATAATCATTGGCTAGAGATTTG
ATGCAAGCCTTAGATACAAGAAAGGAAGGAGTGTTGGATTGGTCATAATTCAAGAATTAC
AGCGTAGTAGCAAAGGACAAAGAGGAGAAAATTAAAGATTTTATTAGAAAGTTTGCTTGA


>Contig8807.0.1.g80(protein)
MTGKNTDQHLDREILEKKQQLQSYYSEIAASDPYAPQGGDNFYVDQARQEDEERERRGGS
RYGGSNSMKYDPKQMLKEKMQQQQDMIKESMMTEQQKNAKLVEEVLTSKEHEQEKKIKEI
EHEVLSELQKCSLHPKNIFQNKNCRHCKKIREEFEVRKNQKLEEIQNNQKGEVAGNKELT
VSEMISANGLFPTSCDYKNGNLPEMIRNTILSCQYFKDLYNLKTFKEVIEEIKTHVSYTE
PWIVGANGVPSTLFCCLYKFMLMRLNEKQVQTLLRYKLSPYVRACGALYVRFLSPNDQLF
DRLSPYMLDEQSFSYSIEKSQSLTFGEYVERLLSEKNYFSILLPRIPVIQFRELQKKLLT
IPEKRKRKQDNLENSNKFNKGQIVFALSKKDQSWHKAKISGIHYESSAPIQKKPVENYGI
EEDFFNEEEGENFDNEYDEDEQDVRAIRKLQVMFIEGPFTKDEEVQEFIGLEDVLLISRN
EEGGQKHRKRSQSNDSWGDDSDAQQSRKAERKRSRSRDRDGDFKTPFDRNENQDDKLMEE
VLRRERDQAAASRKEDYSKRPASYKSALSLALPVGTTRKKDSERKNSPERKLVHVENPAA
YKEEKRDPSKQLSKDEQFERMKKIQEKYGDASALINLTHVFDCYESFAKEYKDKHLINEE
EFDDIFSPLLNDTQIYYNKLQSNGNADFYEAFVALSLFSKGEFDRKIKGIYLAFDQDNSG
SIDRKELLMFLYNGIFGLCKLLGLPIPRRDDVQQYAYNIFKIIDINKNDCIEYSEFAFWI
KESDEIQDFLLKYTGQQTFERARKRYKGLLDYQQQLFDEIAIDFMGEKVILKIFITLNQQ
YATMVELKQVLLKAMKQIQPHILEKLFLILDYDNKGAVSEFEFNTVMKPWASFSATDINN
DNELDSMELKTLIWLIDEEEPLESRVQRDLKLMDRDGSGTIDRLEWIQFLASPDPTTGIE
IFDFNLKKAFDTHDADKSGSIDLEELGDLLMENFEDLIKGKSDENRQIISKLIQSLARDL
MQALDTRKEGVLDWSQFKNYSVVAKDKEEKIKDFIRKFA