Identifiers and Description

Gene Model Identifier

Contig7183.0.g74

Standard Name

PRPF18

Aliases

Contig7183_0_g74

Description

Prp18 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003006303.9991604984848653e-48Prp18 domain containing protei
n
SGDYGR006W0.00000000009998509410508463PRP18 SGDID:S000003238, Chr VI
I from 506070-506825, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7183.0.g74(coding)
ATGAATTCCTTAAGAGACACTCTCGCAAAACTTAAAGAGTAGAAGTAAGCTTAAATATCT
GCAAAAGGTGGGTCTGGGCAAACCTGGGTGAAGAAAGGGGACCTTGAGAAAGAAAGATAA
TAAATTTACATGAATGAGCAGAAGCAAAGAGAAGAGGAGAAGAGACAGAAGTAAGAGTTA
AAATTGAAAGAAATTCAGTAAACTTATTCAAGCCTAGGAGACAGTAAACAATTGAGTGCG
AATGGCTTAAATGGGTAGCATAATAAGTTAACAAGAGATTAAATAATGAGAGGGGTGTAA
AAGGATCCTACTGAATAATTTAACGACACTAAATCTTAGAATCTAATTGAAGAAACTAAA
AATGATAAATAAGAAGAGGAATTAATAATTCCATTATCAAAAGAAGAAGTAATGAGTTAA
CTAAGACAATTAAAGCAAGCTACTACTTTGTATGGAGAGACTGATAAAAAGAGATATTTG
AGATTGCTGGATTGTTAATAACAATTAGCTTCTGGTCTTCTTTAAATTGATGAAGAAACA
CTCAAGTCCTCTAAAACAGTGGAATCTGAAGTTGAATAACTCAATTAAATGAAGTAATTA
GAGTCTTAAATGGAGGCTAATAAACAGAAGCAATTAGGATTGTAAAATTAGTAGCTATTA
ACTTAAAAGCAACAATAACAACAAAAATTCGGTGGATAAGCAGTTTAAGTAAACAGCATA
GACGAGTACATTGGTCTGTACAAAACAGAGGATGAGTTAAAAATTGGCGACAGAAATATC
AATGACTTAGTTGAAATTAAAGAGAAGAACAATTAAACTTTCAGGAACTATAAGAAATTT
GAGAATGCTTGCAAGAGACACCCACCAGAAGAGAAATGCCTAGTCATCTATTTATGGTGC
AAGAAAATGCTCAAAGCTTGGGAGAATGAGCTACTTGAAAAATCAGAAGATTTTCTGAGA
AGTGCTGAGGGAAAGCAAGAAATAAGTACTTAGAAGCAATGCACTCGTCACTGCAAACCT
TTCTTTAAGCAACTTAAAAAGAAGCAAATCAATGATGAAATTATGGATGGCGTGTACCTC
ATCATTCAGTACACATTGATGAAGGAGTATGTGAGAGCTCATGATAAATATTTGGAACTC
GCAATTGGAAATGCTCCCTGGCCTATGGGAGTCACTATGGTAGGTATTCACGAGAGAGCG
GGAAGATCTAAGATTTTCTCAAGTTAGGTTGCACATATTCTTAACGATGAAAATCAGAGA
AAAACCTTATAAGCTGTAAAAAGATTGCTAACTGTATGTCAAAGAATATTTCCAACGGAT
CCATCTAGATGGCCCTCATTTGTAGGAAAAACCTCAATTATAAATAGATTCATAAATAAT
TCATTCTCAACCTACTATGAACCTACACTACATGCATAAATTTATCGCAGAGCTTTCAAT
ATTCTTGAAGACCAAGATGTAGATCCTTAATTTGTGGAATTAGAGATAATAGACGTTTTC
CCTCATGATCATCCCTTACTGGATAAAGACCCAGATTACAGTGATCTTGCCCGTGAGATG
TCAATTACCCTGAATGATATAGTTAAGAATAATTTCGGGACAGACGCATCTTCAAAAATT
CACGGCTACATGTTCATATATGACGCGAGCAATAAGTTTACTTTCGACACACTATCATGT
TTAATGGAGACTATTAAAGAAATAGAGAAAAGTGAGCGCAGAGGCAAAAAATCAATGATG
TATTAGCCTAAGAAACTTGTAATTGGAAATAAAAAAGACTTAAAACGAAAGAAATAGGTG
CTGGAGAAAAATGACTTGAAAAAGTTGGAAGGTATGAGATATCGAGAGGTAAGTGCTTTG
ACTAATCAAGGAATATAAGAAGCTTTCAAAATTCTGATTGGAGATATAAATAGTTGCAAC
ATACTTCATAAGGAATTTTATGATTTGGAAAAAATGAAAAATCGTGAATAAGATGAACTC
AAAGAAATGGAGGAGTATGGAGGTAAAAACATGAGAAGTAAAAGTTAAGGAGGACTTTTT
GGGATGCTTCCTTTCGGTGGCTGTTATGGAACCAGAGACGATGGAACCGATGAAGAAGAA
TAGTAATATTCAAGTCAAGAAGAATATGATGAAAACGATCCAAAGAACTCTCAAAGAGAT
ACTAAAGGAGGCTTAAATTAATCAGGAACAAAGGGCAAGAATAACAATGATAGTGAAAGT
GTGAATAATGAAGAGACTAATTGTAATATATATTGA


>Contig7183.0.g74(protein)
MNSLRDTLAKLKEQKQAQISAKGGSGQTWVKKGDLEKERQQIYMNEQKQREEEKRQKQEL
KLKEIQQTYSSLGDSKQLSANGLNGQHNKLTRDQIMRGVQKDPTEQFNDTKSQNLIEETK
NDKQEEELIIPLSKEEVMSQLRQLKQATTLYGETDKKRYLRLLDCQQQLASGLLQIDEET
LKSSKTVESEVEQLNQMKQLESQMEANKQKQLGLQNQQLLTQKQQQQQKFGGQAVQVNSI
DEYIGLYKTEDELKIGDRNINDLVEIKEKNNQTFRNYKKFENACKRHPPEEKCLVIYLWC
KKMLKAWENELLEKSEDFLRSAEGKQEISTQKQCTRHCKPFFKQLKKKQINDEIMDGVYL
IIQYTLMKEYVRAHDKYLELAIGNAPWPMGVTMVGIHERAGRSKIFSSQVAHILNDENQR
KTLQAVKRLLTVCQRIFPTDPSRWPSFVGKTSIINRFINNSFSTYYEPTLHAQIYRRAFN
ILEDQDVDPQFVELEIIDVFPHDHPLLDKDPDYSDLAREMSITLNDIVKNNFGTDASSKI
HGYMFIYDASNKFTFDTLSCLMETIKEIEKSERRGKKSMMYQPKKLVIGNKKDLKRKKQV
LEKNDLKKLEGMRYREVSALTNQGIQEAFKILIGDINSCNILHKEFYDLEKMKNREQDEL
KEMEEYGGKNMRSKSQGGLFGMLPFGGCYGTRDDGTDEEEQQYSSQEEYDENDPKNSQRD
TKGGLNQSGTKGKNNNDSESVNNEETNCNIY