Identifiers and Description

Gene Model Identifier

Contig21646.0.1.g103

Standard Name

PRP8

Aliases

Contig21646_0_1_g103

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000793009.997093137033517e-262Mov34/MPN/PAD-1 family protein
SGDYHR165C9.997093137033517e-262PRP8 SGDID:S000001208, Chr VII
I from 436948-429707, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21646.0.1.g103(coding)
ATGTCTTCCAAGAGATTTAGACAAGATAAAAGAGTGTATCTTGGGGCTTTAAAGTATATT
CCTCATGCAATCTACAAACTTCTGGAAAACATGCCCATGCCTTGGGAGCAAGTTAGAAAT
GTGAAAACATTGTATCATATCACTGGAGCCATCACATTTGTCCATGAAGTACCTAAAGTC
ATTGAGCCAGTCTATACTGCTTAATGGGGTAGCATGTGGATTATGATGAGAAGAGAAAAG
AGAGATAGACGTCACTTTAAAAGAATGAGATTCCCTCCTTTCGATGATGAAGAGCCACCT
CTTGACTATGGTGATAACATTTTGAATGTTGAACCTCTAGAAGCTATTCAAATGGAGCTT
GACGAAGAGGAAGATAACCCAGTTTTCGATTGGTTTTATGATCATTAACCATTAAAGTAT
ACCAAGCATGTAAATGGACCCTCCTACAGACTTTGGAGACTAACTCTCCCTATAATGGCA
AATCTTCATAGATTATCTAACCAACTTTTAAGTGACCTTATTGACAAAAATTACTTCTAC
CTATTTGATAAGCAAAGTTTTTTCACTGCTAAGGCTTTAAATATGGCTATTCCAGGAGGA
CCTAAGTTTGAACCACTCTATAGAGATATTTATGATGAAGACGAAGACTGGAATGAGTTT
AATGACATAAACAAGATCATTGTTAGACATTAAATTAGAACTGAATATAAAATAGGATTC
CCTCACTTATATAATAGTAGACCCAGGAAAGTAGAGCTTAGTCCATATCATACTCCAGCA
GTATGCTTCATTAAGAATGATGATCCAGAACTCCCAGCATTCTATTTTGATGAAGTGATA
AATCCCATCTCTGCTTATAGAATGGAAAAGTTTAAGAATCTCTCAGATAACTTTGAAGTC
ACAGATGAAGATTTAGAGGAGTTTGAACTTCCTGAATAAGTACAACCAATTCTTGCTGAA
GAACCTCTATATAACGAAAATACAGTTAATGGAATTAACTTGTACTGGGCTCCAGAGCCA
TTTAACAAAAGAACTGGTAAAACAAGAAGATGCTATGATATTCCACTTGTCTCATCATGG
TTTAAGGAAAGATGTCCTCAAGGATATCCAGTTAAGGTGAGAGTTAGTTATCAAAAGTTA
CTTAAGGTTTGGGTTCTCAATCAATTACATCATCATACCCCAAAACCATAGAACAAAAAG
TCATTACTAAAGGCTTTCTAAAAAACTAAATTCTTCCAACTTACTGAAATAGATTGGGTT
GAAGCAGGTCTTTAAGTGATTAGGCAAGGATATAACATGCTTAACTTGCTGATACATAGA
AAAAATTTGAACTACTTACATTTAGATTATAACTTCAATTTAAAGCCCGTCAAAACACTA
ACAACTAAAGAGAGAAAGAAGTCAAGATTTGGTAATGCCTTCCACTTAATTAGAGAAATT
TTGAGATTGACTAAGTTAGTTGTTGATTCACATGTTCAATATAGACTTGGAAATATCGAA
GGATTTTAATTGGCAGATGGTTTATAATACATTTTTGCACATGTTGGACAGTTGACTGGT
ATGTATAGATATAAGTACAGACTTATGAGATAAGTTAGAATGACTAAGGATCTTAAGCAT
TTGATCTATTACAGATTTAATACAGGCCCTGTAGGGAAAGGTCCAGGTGTTGGATTTTGG
GCACCTGGATGGAGAATTTGGCTATTCTTCCTGAGAGGTATTATCCCTCTTGTTGAAAGA
TGGCTAGGAAATCTACTCGCAAGATAATTTGAAGGAAGACATTCAAAGGGTATTGCGAAG
ACTGTCACGAAACAAAGAGTTGAATCCTAGTATGATCTCGAATTGAGAGCTGCGGTTATT
ATGGATATTACAGATATGATGCCTGAAGGAGTTAAAGCTAATAAGACCAAAACTATTCTT
TAGCATTTAAGTGAAGCATGGAGATGTTGGAAAGCTAACATTCCTTGGAAAGTACCAGGT
TTACCAGCACCTTTAGAAAATTTAATCTTGAGATATGTGAAATCAAAAGCTGATTGGTGG
ACAAATGCAGCTTATTATAATAGAGAAAGAATTAGAAGAGGAGCTACTGTTGATAAGACA
GTTTGCAAGAAAAATCTCGGAAGACTTACTAGACTTCATTTGAAATCTGAACAAGAAAGA
TAACATAATTATCTTAAGGATGGTCCTTACACAACTCCAGAAGAAGCTATAGCTATTTAC
ACAACTTTTGTTCATTGGCTAGAATCAAGAAAGTTTATACATATTCCATTCCCTCCACTT
AATTACAAAAATGATACTAAGCTTTTTGTACTTTGTTTAGAAAGGCTAAAGGAAGCTTAC
AGTGTCAAATCAAGATTAAATTAATCTCAAAGAGATGAACTAAGTTTGATTGAATAAGCT
TATGATAATCCTCATGAAGCACTATCAAGAGTTAAAAGGCATTTGCTCTGCCATAGAGCC
TTTAAGGAAGTAGGAATCGAATTTATGGATCTTTACTCTCACTTGATCCCAGTTTATGAC
ATTGAACCATTAGAAAAGATAACAGATGCATATCTTGATTAGTATCTTTGGTATGAAGCA
GATAAAAGAAATCTCTTCCCTAATTGGATCAAACCAGCAGACTCAGAACCACCCCCTCTT
CTTGTATATAAGTGGTGTCAAGGAATAAATAACTTAACAGACATTTGGGATGTATCAGAA
AATCAAAATGTTGTTCTTCTTTAAACAAGATATGAAAAACTGTATGAAAAGGTAGATTTT
ACTTTACTGAACAGACTATTGAGATTGATTGTTGATCACAATTTAGCTGATTATATGACT
ACTAAGAATAACGTTGTTATATCTTTCAAGGATATGTCTCACACAAATTCATATGGGTTA
ATTAGGGGTCTTCAATTTGCAAGTTTTATTACTCAATACTATTCACTCATTCTTGATATC
ATAATTCTTGGACTTTAAAGAGCATCTGAAATCGCTGGACCTCCATCATCACCAAATGAA
TTTATGAGTTTCAAAGATGTTGATAGTGAAACTAGACATCCAGTTAGATTATATTGCAGA
TATATTGATAGACTATACATGATTTTCAGATTCACTGAATAAGAATCAAGAGAACTTATT
TAAAGATATTTGACTGAGAATCCTGATCCAAATAATGAGAATATTGTTGGATATAACAAT
AAGAAATGTTGGCCAAGAGATTGTAGAATGAGATTAATGAAGCATGATGTTAATCTTGGC
AGAGCAGTGTTTTGGGAAATAAAAAACAAATTACCAAGAGCTCTAACAACTGTTGATTGG
GAAAACAGTTTTGTTTCAGTTTACTCCAAAGATAATCCAAACCTTCTCTTCAACATGTGT
GGATTTGAAGTAAGAATTTTACCAAAGATAAGAGCAGTACAAGAAGAATTTTCTCAAAAG
GATGGTACTTGGAAACTTCAAAATGAAAATACAAAAGAAATAACTGCTCAAGCATTTGTT
AAAATTGATGATGAAAGTTTGAAAAAGTTCGAGAATAGAGTTAGGTAAATTTTGATGGCA
AGTGGATCGACCACATTTACCAAAATCGCTAATAAATGGAATACTACTCTGATTGGTTTA
ATGACTTACTATAGAGAAGCTACAGTTCAGACAGAATAAATGTTAGACTTGCTTGTAAAA
TGTGAGAACAAAATACAGACTAGAATTAAAATTGGATTGAATTCAAAGATGCCAAGTAGA
TTCCCACCAGTGGTGTTTTATACTCCAAAAGAACTTGGAGGTCTTGGTATGCTTTCTATG
GGTCATATATTAATACCCTAAAGTGATTTAAGATTTTCAAAACAAACTGACACTGGAATC
ACTCATTTTAGAGCTGGCATGAGTCATGAAGAAGATTAACTTATACCCAATCTTTATAGG
TATATTCAATCTTGGGAGTCAGAGTTTATTGATTCTCAAAGAGTTTGGGCTGAGTATGCA
TTAAAGAGATAAGAAGCTGCAGCACAAAATAGAAGACTCACATTAAATGATCTTGAAGAT
TCCTGGGATAGAGGTATTCCAAGAATTAATACACTTTTCTAAAAGGATAGATTGACTTTA
GCATATGATAAAGGTTGGAGAGTGAGACAAGATTTTAAGCAATATTAAGTTTTGAAGTAA
AATCCTTTCTGGTGGACTCATCAAAAGCATGATGGAAAGCTTTGGAACCTTAATAATTAC
AGGACTGATATGATTCAAGCTCTTGGTGGTGTTGAAGGTATCTTAGAACATACTCTTTTC
AAGGGAACATATTTCCCTACTTGGGAAGGTCTCTTTTGGGAGAAAGCATCAGGTTTCGAA
GAATCAATGAAGTATAAAAAACTTACACATGCTTAAAGGTCTGGTCTTAATCAAATTCCA
AACAGAAGATTTACACTTTGGTGGTCACCAACAATTAACAGAGCTAATGTCTATGTTGGT
TTCTAAGTGCAACTTGATCTTACTGGTATATTTATGCATGGTAAAATACCAACTCTAAAG
ATATCATTGATTCAGATTTTCAGAGCTCATTTGTGGCAAAAGATACATGAATCAATTGTT
ATGGATCTTTGTTAAGTATTCGACTTGGAACTTGACTCATTAGAAATTGAAACTGTTTAA
AAAGAAACAATTCATCCAAGAAAGTCCTACAAAATGAACTCATCTTGTGCAGATGTGCTT
TTATTCGCTGCATTTAAATGGTAAATCTCAAAGCCATCTCTTATCCATGAACAAAAAGAT
TAATATGATGGAACTACCTCAACAAAGTATTGGATAGATGTTTAACTCAGATGGGGAGAT
TATGATTCTCATGATATTGAAAGATACTCGAGAGCTAAATTCTTGGATTACACTACAGAC
AATATGTCTATTTATCCCTCTCCAACTGGATGCTTGATTGGTATTGATCTTGCTTATAAT
TTGCACAGTGGTTTTGGAAATTATTTCCTTGGATCTAAGCAACTTCTCCAGCAAGCAATG
AATAAGATCATGAAAGCTAACCCTGCTTTGTATGTACTTCGTGAAAGAATTAGAAAATGT
CTACAGCTATATTCATCTGAACCAACTGAACCATATCTTAATTCACAAAATTATGGAGAG
CTCTTCTCTAACTAAATTATTTGGTTTGTTGATGACACAAATGTCTACAGAGTTACCATT
CACAAAACTTTCGAAGGTAACTTGACTACTAAGCCAATTAACGGAGCAATTTTTATTTTC
AATCCAAGGACAGGCCAATTGTTCCTAAAAATTATTCACACTTCAGTTTGGGCAGGTCAA
AAACGTCTTGGTTAACTTGCAAAATGGAAGACTGCTGAAGAAGTAGCAGCACTTATTAGA
TGTCTACCAGTTGAGGAGCAACCTAAGTAAATTATTGTAACAAGAAAAGGTATGCTAGAT
CCACTTGAAGTTCATTTACTTGATTTCCCAAATATTGTAATTAAAGGTAGTGAACTATAA
CTTCCATTCTAAGCTTGCTTGAAAATTGAGAAGTTCGGAGATAGAATACTTAAAGCTACA
GAGCCATAAATGTTGCTCTTTAACTTATACGACGATTGGTTGAAAGGTATTCAAAGTTTC
ACAGCTTTCAGCAGACTTATTCTTATTTTGAGAGCTATGCATATAAATGCAGAAAGAGCT
AAGATTATTTTGAAACCAGATAAAGTTACTGTAACTTTGCCACATCACATTTGGCCAAAT
CTATCTGATGAATAATGGGTTAAGGTAGAAGTAGAACTTAAGAATCTAATTCTTGCAGAT
TATGCAAAGAAAAATAATGTCAATGTTGCTTCCCTCACTTAATCTGAGATTAAAGATATC
ATTCTTGGTATGGAAGTGGCCCCAGTAAATATTCAGAAGTAAGAAATCGAAAGAATTGAG
AAGCAAAACAAAGAGGCATCACAACTTCAAGCTTAAAATGTCAAATCAACAAACATCCAT
GGACAGTAAATGGTTGTTTAAGTTCTAAGTGGCTACGAAAGAGAAAAGTTTATGTCGAAA
ACTGACTGGAGAATGAGAGCTATTTCAGCAACTAGCTTACATTTAAGAACTAATCACATT
TATGTAAACTCCGAAGATTTGAAAGAAAGTGGATTCACATATGTTTTGCCTAAAAATATT
CTTAAGAGATTTATTTGCATTAGTGATCTTAGAATTCAAATTGCAGGTTACTTATATGGT
ATCACTCCACCAGATAACCCATATGTCAAAGAAATTAGATGTATAGTAATGGTTCCACAA
ATAGGTACTTATCAATATGCAACGCTTCCTCACTAAATGCCTGAGCATACTTACTTGAAA
GATATGGAGCCACTTGGTTGGATTCATACTCAACCTTCAGAAAGCCACGCACTTTCCTCT
TTCGATGCTTCAATTCATTCAAGATTGCTGGTTGAAAATACAAATTGGGATGTTGAATCT
AGTATTATCATAACTAGTAGTTTCACTACAGGTTCTTGTTCACTTTCAGTTTATAAGTTA
ACTTAACAAGGAGTTGAATGGGGCAAAAACAACACTGAGACAACACCTAATCCCCCTGGC
TATGGATCTCTAATGTACGAAAAAGTTCAAATGATTCTATCAGACAAGTTCCTAGGTTTC
TTCATGGTACCAGAGGGAGGAATTTGGAACTACAACTTTAATGGAATCAACTTTGCAGAG
AATATGAAGTATCAGTTGAACTGCACATTTCTTAGATTTTGCAAAGAATGA


>Contig21646.0.1.g103(protein)
MSSKRFRQDKRVYLGALKYIPHAIYKLLENMPMPWEQVRNVKTLYHITGAITFVHEVPKV
IEPVYTAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYGDNILNVEPLEAIQMEL
DEEEDNPVFDWFYDHQPLKYTKHVNGPSYRLWRLTLPIMANLHRLSNQLLSDLIDKNYFY
LFDKQSFFTAKALNMAIPGGPKFEPLYRDIYDEDEDWNEFNDINKIIVRHQIRTEYKIGF
PHLYNSRPRKVELSPYHTPAVCFIKNDDPELPAFYFDEVINPISAYRMEKFKNLSDNFEV
TDEDLEEFELPEQVQPILAEEPLYNENTVNGINLYWAPEPFNKRTGKTRRCYDIPLVSSW
FKERCPQGYPVKVRVSYQKLLKVWVLNQLHHHTPKPQNKKSLLKAFQKTKFFQLTEIDWV
EAGLQVIRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLIREI
LRLTKLVVDSHVQYRLGNIEGFQLADGLQYIFAHVGQLTGMYRYKYRLMRQVRMTKDLKH
LIYYRFNTGPVGKGPGVGFWAPGWRIWLFFLRGIIPLVERWLGNLLARQFEGRHSKGIAK
TVTKQRVESQYDLELRAAVIMDITDMMPEGVKANKTKTILQHLSEAWRCWKANIPWKVPG
LPAPLENLILRYVKSKADWWTNAAYYNRERIRRGATVDKTVCKKNLGRLTRLHLKSEQER
QHNYLKDGPYTTPEEAIAIYTTFVHWLESRKFIHIPFPPLNYKNDTKLFVLCLERLKEAY
SVKSRLNQSQRDELSLIEQAYDNPHEALSRVKRHLLCHRAFKEVGIEFMDLYSHLIPVYD
IEPLEKITDAYLDQYLWYEADKRNLFPNWIKPADSEPPPLLVYKWCQGINNLTDIWDVSE
NQNVVLLQTRYEKLYEKVDFTLLNRLLRLIVDHNLADYMTTKNNVVISFKDMSHTNSYGL
IRGLQFASFITQYYSLILDIIILGLQRASEIAGPPSSPNEFMSFKDVDSETRHPVRLYCR
YIDRLYMIFRFTEQESRELIQRYLTENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLG
RAVFWEIKNKLPRALTTVDWENSFVSVYSKDNPNLLFNMCGFEVRILPKIRAVQEEFSQK
DGTWKLQNENTKEITAQAFVKIDDESLKKFENRVRQILMASGSTTFTKIANKWNTTLIGL
MTYYREATVQTEQMLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSM
GHILIPQSDLRFSKQTDTGITHFRAGMSHEEDQLIPNLYRYIQSWESEFIDSQRVWAEYA
LKRQEAAAQNRRLTLNDLEDSWDRGIPRINTLFQKDRLTLAYDKGWRVRQDFKQYQVLKQ
NPFWWTHQKHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFE
ESMKYKKLTHAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLK
ISLIQIFRAHLWQKIHESIVMDLCQVFDLELDSLEIETVQKETIHPRKSYKMNSSCADVL
LFAAFKWQISKPSLIHEQKDQYDGTTSTKYWIDVQLRWGDYDSHDIERYSRAKFLDYTTD
NMSIYPSPTGCLIGIDLAYNLHSGFGNYFLGSKQLLQQAMNKIMKANPALYVLRERIRKC
LQLYSSEPTEPYLNSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIF
NPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRCLPVEEQPKQIIVTRKGMLD
PLEVHLLDFPNIVIKGSELQLPFQACLKIEKFGDRILKATEPQMLLFNLYDDWLKGIQSF
TAFSRLILILRAMHINAERAKIILKPDKVTVTLPHHIWPNLSDEQWVKVEVELKNLILAD
YAKKNNVNVASLTQSEIKDIILGMEVAPVNIQKQEIERIEKQNKEASQLQAQNVKSTNIH
GQQMVVQVLSGYEREKFMSKTDWRMRAISATSLHLRTNHIYVNSEDLKESGFTYVLPKNI
LKRFICISDLRIQIAGYLYGITPPDNPYVKEIRCIVMVPQIGTYQYATLPHQMPEHTYLK
DMEPLGWIHTQPSESHALSSFDASIHSRLLVENTNWDVESSIIITSSFTTGSCSLSVYKL
TQQGVEWGKNNTETTPNPPGYGSLMYEKVQMILSDKFLGFFMVPEGGIWNYNFNGINFAE
NMKYQLNCTFLRFCKE