Identifiers and Description

Gene Model Identifier

Contig17451.0.g46

Standard Name

PRP6

Aliases

Contig17451_0_g46

Description

PRP1 splicing factor, N-terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008492202.0004037638327014e-151hypothetical protein
SGDYBR055C9.99860868304602e-64PRP6 SGDID:S000000259, Chr II
from 347301-344602, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17451.0.g46(coding)
ATGGTATTTAGAAAGCCTAATTTCGGTCCCCCACCCGAAAATTACATAGCTGGTCTTGGC
AGAGGAGCAAGTGGTTTCGTTACAAGAGCAGACTTCGGTCCATCGAAAGTAGGAGTACCA
ACTGGGACCGCATAGCCGGGAGAATTGTAGGTAAATCCTTAACCAATAAACAACTAATAC
TTATCATTTCACTTTGAATATAGACCCTAAGGAGCACCTGCTTAATCAGGACCTGGCGTA
GCACCTCAAATGAGGCAAGCGCCCACTGCTGCTATGCGAGAGCTTACAAGTAAAGGCGGC
CAAAGAGGACAAGATAAAGAGCAAGATTTCTCAGATGCGAACTTTGATGAATGGAGTGGG
TTTGGCGGTAGTTTGTTTACTGGGGGAGCAGATGATGCAGAAGACAAAGAAGCTGACAAT
TTGTTTTAAAGAGTGGATGAGTTTATGGATGGGAGACGCAAAAAGAAGCGAGAAGAGAAA
TTCAAAGAATAAGAAAAGAAACTTGAAAAGGATAAGAAAGACATTCAAACTCAATTTTCT
GACTTAAAAAGGCAGCTTGTAAATGTGAGTAGAATTGAATGGGAAGCTCTACCAGATGCG
CCAGATTTGGTCAAAAGAACCAAAAGACAAAAGATTGATAACTTTTAGAGATACACTCCT
GTTCCTGATAGCGTCATAGATCAAGCCAGATTAGACAGTTAAACAAATACTTTTATTGAT
CCTAACTCAGGTGCAAGTACTTAACTTATTAATCAAGCAAATGCTGCTAGTACAACAGGC
TTCTCTTCCATCATGAACGGTGGAATGCAAACAAGTATTGGAGATGTAGGTATGGCTAGA
GGATAACTATTAAATTTGAAACTTGCCTCCGCAGAATCAGTGATATCTAATGTTGCAAAA
CAATCAACTTCAACATTTGATAGAGATGGTTATATGACTGCTTTAAATAGCTAACAGTTC
AACAATTTGCACGATATTAATGATTTCAAAAAGGCAAGAAAGATGTTTAAGAGTGTTATT
CAATAAAACCCATAAAATTCGATGGGGTGGATAGCAGCTGCAAGAATAGAGCATCTTGAT
GGAAAAGTATAGGAGGCTAGAAATATTATTAATTAAGCTTGCCATGAGTTGCCTAATGAC
GAGGATATTTGGTTAGAAGCTGCCAAATTATGTCCGCCTGAAAAGGTTTAAGCATTACTG
GCCAAAGCAATTTCAAACATCCCAAAATCTAAGAAGCTCTGGTAAATGGCAGCCCTTAAA
GAACAAGAAGTAGAAATTAAAAAGTAAATTTATCAACGTGCTTTAGAGTAATTGCCTACA
GATTTGGAGCTTTGGAAAGAATCAATCTAACTTGCTAGCCCCGATGAAGCCAAGACTCTA
CTCTATAGAGCTGTAAAATGTGTTCCAGACTCAACTGATCTTTGGTTAGCTCTTGCAAGA
CTCGAAAGTTATGAAAATGCTCGTACTGTTTTAAACGAAGCCAGAGAGGCTGTACCAACT
GATCATACAATTTGGGTTAATGCTGCTAAGTTGGAGGAGGCTTAGGGCAATAACTCGTTG
GTTGATAAGATCATCAATCGTGCAATCAAGAAACTTAGTAAGAATGTTAATCTTAAGAGA
GATCAGTGGTTGAGAGAGGCCGTCCAGGCTGAAGAGAGTGGGTCTTTGATTACATGTAGA
GCTATCATCAAAGAAACAATGCATTTTGGAATGGAAGATATCACAAACACCTATCAAGAT
GAGGCAGAGTAAAATAGATAGATAAGAAATATCTGGAAAGAAAACGCAGAAGAGTGCATT
CGTTAAGGTGCTTATGAAACAGCAAGAGCTTTATATTTCAACGCCCTTAGAGAATATCCA
AAGAAGAAGAGTATTTGGTTCAGTGCCATTAAACTTGAGGAGGAGTACGGCAGTAAGGAA
AACCAAGATGATTTACTCAGGAGAGCAAGAGAAGAAACTGATACTGTCTTTTTCTATCTT
AAACATGCTAAGTTCACTTGGAAGAATCAGAGAAATGCAATTAAAACAGCTCAAATACTT
AACGAGGGTTACAAGAGACATCCAGATTCAGAAGATATAGTCCTTGCTTTGCAGAAGTTC
TATAGAGAAAATAATCAACTAAAAGAAGCAGAAACTTTACTCTAATAGGCAACTGAGTAA
ATTCCAACTTCTGAGAGAGTAGCTATGTAAGCTGTGCAGCTATAAAGAGAACTTATGAAT
TTGCAGAAAGCATTAAGCTTAGTAGATGATGCACTAAAATAACATAGGACTATTCATAAA
TTATGGTTGATCAAAGCGCATATTTTACAGGATTTAGGATCGTAAGCTGCTAAATAAGAA
AATGAAGTGTAAAAAGTATCTTATTACGAACAATCTAGAAAGGTATATGATGAAGCCTTG
ACTGTTGAAGAGGTGAAAACACAAAGAATTATTTGGCTTGACTATGCTAGATTTGAGACA
GAACAGGAAGCATTCACAAGAGCAAGAACTGTCTTATAAAAGGCAAGAATCAGAATGCCA
AATGATGATGAAATATGGTTAAGCTCAGTCAGATTAGAAATTAAGAGTGATAATCTTAAG
ATTGCTCAGAACTTATTATCACAGGCTTTATAGAAATGCCCTAACTCAGGCAGACTATGG
GCTTAACTAATAGAAATGGAGCCATCAGCCACAAGAAAAACTTAATCCTTCAACGCAGCA
ACCAAAGTAGGTAATGACTCAGATCTTTTCCTGGCTGTAGCTAAAGTTCTCTGGAGTGAA
ATGAAGACTGAAAAGATGAAGAAGTGGATTAAAAACGCAATTGCAATTAACCCAGACAAT
GGAGATGCCTGGGCACTCTACTATAAATATGAGATGGAATTCGGAAACGGAGAGACATAG
AAGGAAGTGGTAGATAAGTTCCTGGAAGCTGAACCTAGACACGGGGAGATGTGGGCTAGA
GAGGTTAAGAAAGTAGAGAATTGGAGGAGAGACAAGGTAGAATTACTCAAGAAAGTCTCA
GGTGAGATCAAGATGTTCGAGTAGATTTGA


>Contig17451.0.g46(protein)
MVFRKPNFGPPPENYIAGLGRGASGFVTRADFGPSKVGVPTGTAQPGELQVNPQPINNQY
LSFHFEYRPQGAPAQSGPGVAPQMRQAPTAAMRELTSKGGQRGQDKEQDFSDANFDEWSG
FGGSLFTGGADDAEDKEADNLFQRVDEFMDGRRKKKREEKFKEQEKKLEKDKKDIQTQFS
DLKRQLVNVSRIEWEALPDAPDLVKRTKRQKIDNFQRYTPVPDSVIDQARLDSQTNTFID
PNSGASTQLINQANAASTTGFSSIMNGGMQTSIGDVGMARGQLLNLKLASAESVISNVAK
QSTSTFDRDGYMTALNSQQFNNLHDINDFKKARKMFKSVIQQNPQNSMGWIAAARIEHLD
GKVQEARNIINQACHELPNDEDIWLEAAKLCPPEKVQALLAKAISNIPKSKKLWQMAALK
EQEVEIKKQIYQRALEQLPTDLELWKESIQLASPDEAKTLLYRAVKCVPDSTDLWLALAR
LESYENARTVLNEAREAVPTDHTIWVNAAKLEEAQGNNSLVDKIINRAIKKLSKNVNLKR
DQWLREAVQAEESGSLITCRAIIKETMHFGMEDITNTYQDEAEQNRQIRNIWKENAEECI
RQGAYETARALYFNALREYPKKKSIWFSAIKLEEEYGSKENQDDLLRRAREETDTVFFYL
KHAKFTWKNQRNAIKTAQILNEGYKRHPDSEDIVLALQKFYRENNQLKEAETLLQQATEQ
IPTSERVAMQAVQLQRELMNLQKALSLVDDALKQHRTIHKLWLIKAHILQDLGSQAAKQE
NEVQKVSYYEQSRKVYDEALTVEEVKTQRIIWLDYARFETEQEAFTRARTVLQKARIRMP
NDDEIWLSSVRLEIKSDNLKIAQNLLSQALQKCPNSGRLWAQLIEMEPSATRKTQSFNAA
TKVGNDSDLFLAVAKVLWSEMKTEKMKKWIKNAIAINPDNGDAWALYYKYEMEFGNGETQ
KEVVDKFLEAEPRHGEMWAREVKKVENWRRDKVELLKKVSGEIKMFEQI