Identifiers and Description

Gene Model Identifier

Contig6240.0.g71

Standard Name

PRP4b

Aliases

Contig6240_0_g71

Description

pre-mRNA processing factor 4 (PRP4) like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08799 ) pre-mRNA processing factor 4 (PRP4) like
  • ( pfam09810 ) Defects in morphology protein 1, mitochondrial precursor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007009701.000137892321693e-31hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6240.0.g71(coding)
ATGGATAACAATGATGATACTCTCTCGACATCAACAAGAGCTTCTGGTTTTTCAGTTCGA
CCTATTGTTGTGAATTAGACTCTGAGACCAGGTCAGTAATCCTTACTAGTAAATTAAGCT
ATGCAAGCCAGAGCAGCAATGCAGTCTCAGTCAGACAACTAATCTACGATTCTTACACTT
TCTGATTCAAATGCTGAGGCAATCAGAAATCATGAGAATTTGATGAAAGCTTATGAATTA
TAGAGAAAGTCTAAGAATCTCCCAATTCCAACAAATGATAAAGAAGTGAAGTTAAGATTG
AGAGAAATGGAGCAACCAATTTGTTTGTTTGGAGAAGATCCAGGTGATCGCAGAGAGAGA
TTAAGAAATGTTATTACTAAGTATTACTTAGAAAATGGTAGACCACCTACTTTCTTTTAA
AAGTTTGTGGATGATTAAGGAGGATCAAGCTAAGCCAAAGATGAAAATGATGAAAACGAA
ATGTTTTACACTGAGGGCACTGAAGACCTTAAGAAAGCTAGATTGGAGATTGCCAAGTAT
TCACTACCAAGAGCTCAAGTCAGATTAGCAGAGTCCAAGAGAAGAAGAAACGAATGTATA
GCCCTATGA


>Contig6240.0.g71(protein)
MDNNDDTLSTSTRASGFSVRPIVVNQTLRPGQQSLLVNQAMQARAAMQSQSDNQSTILTL
SDSNAEAIRNHENLMKAYELQRKSKNLPIPTNDKEVKLRLREMEQPICLFGEDPGDRRER
LRNVITKYYLENGRPPTFFQKFVDDQGGSSQAKDENDENEMFYTEGTEDLKKARLEIAKY
SLPRAQVRLAESKRRRNECIAL