Identifiers and Description

Gene Model Identifier

Contig6514.0.g50

Standard Name

PRP4a

Aliases

Contig6514_0_g50

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007009706.998828886836733e-138hypothetical protein
SGDYPR178W2.0002571866765887e-62PRP4 SGDID:S000006382, Chr XVI
from 892332-893729, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6514.0.g50(coding)
ATGGATAATAATAATGATGATACTCTCTCGACATCAACAAGAGCTTCTGGTTTTTCAGTT
CGACCTATTGTTGTGAATTAGACTCTGAGACCAGGTCAGTAATCCTTACTAGTAAATTAA
GCTATGCAAGCCAGAGCAGCAATGCAGTCTCAGTCAGACAACTAATCTACGATTCTTACA
CTTTCTGATTCAAATGCTGAGGCAATCAGAAATCATGAGAACTTGATGAAAGCTTATGAA
ATATAGAGAAAGTCTAAGAATCTCCCAATTCCAACAAATGATAAAGAAGTGAAGTTAAGA
TTGAGAGAAATGGAGCAACCAATTTGTTTGTTTGGAGAAGATCCAGGTGATCGCAGAGAG
AGATTAAGAAATGTTATTACTAAGTATTACTTAGAAAATGGTAGACCGCCTACTTTCTTT
TAAAAGTTTGTTGACGATCAAGGAGGATCAAGCTAAGCCAAAGATGAGAATGATGAAAAC
GAAATGTTTTACACTGAGGGTACTGAAGACCTCAAGAAAGCTAGATTAGAGATTGCCAAG
TATTCACTACCAAGAGCTCAAGTCAGATTAGCTGAGTCCAAGAGAAGAAGAAACGAAGTT
GACCGATTGAAAGAAGACCAGGAAATTGAAGATTTTCTTAATAGTGTATAGCCCTATGAG
GTGAAAGAATCGTAATATGGGGATGATAGAAATGTCTCAAGAGGAGCATTGTCTCCTGAT
GAGGAGTTGTTCGCAACAAGTGGCTGGTCTGGTGTCTGCAAGATATGGGGAGTGCCTGAT
TGCTAACTCAGAACTGAATTGAAGGGGCACAGTGACAGAGTCAACTGTATTAAGTTTCAT
CCCTTCACTGGAAGTATTCCTGAAGATGGTCCCAATGTTGCAACTGCTAGTGCTGATAAA
ACTGTAAGACTGTGGAGTCTGAACCCAGAGTATGAATTCCAAAAATCAATAGAGCTTCAT
GGGCATGAAGATACAGTACATAACATAGATTTCCACCCAATGGGCCAACATTTAGCATCA
TCAAGCGCAGATAAGACTTGGAGACTTTGGGATCTCACTACAAGATAAGATATCCTGGTT
CAGGAAGGTCATGCTGGAGAAGTTTATCCCTTGACTTTTTAAAGAGATGGTTCACTATTG
GCAACAGGTGATTTCCAAGGTATTGGTCTTGTTTGGGATTTGCGAACTGGTTAAAACGTC
CTTTCTTTCTAAGGCCACGTCAAAAGAATAATTTCAATGCGATTCTTACCTAATGGCTAT
TAAGTAGCTACAGGAAGTGACGATAACACAGTTAAAATTTGGGACATCAGAAGAAAGAAT
TGCGTTTAGACAATTCCAGCACACACCAAACTCATCTCTGATGTGAAATTCATTGAGCAG
CCTAACTCAAGTAAGCTGCTCATGCTGACAACATCTTATGATAACAAGTGTAAGATATGG
GGTAGTACGGGAGAAACAGGTGATTGGATAGTGCTTAGAACTCTTAATGGTCATGAGAAT
AAAGTCACTTCAGTCAATATGACTAAGGACTTGAAGTATGTTATAACCACTTCATTTGAT
AGAACATTCAAGTTGTGGACACCAAAGCAAGTTTACTGA


>Contig6514.0.g50(protein)
MDNNNDDTLSTSTRASGFSVRPIVVNQTLRPGQQSLLVNQAMQARAAMQSQSDNQSTILT
LSDSNAEAIRNHENLMKAYEIQRKSKNLPIPTNDKEVKLRLREMEQPICLFGEDPGDRRE
RLRNVITKYYLENGRPPTFFQKFVDDQGGSSQAKDENDENEMFYTEGTEDLKKARLEIAK
YSLPRAQVRLAESKRRRNEVDRLKEDQEIEDFLNSVQPYEVKESQYGDDRNVSRGALSPD
EELFATSGWSGVCKIWGVPDCQLRTELKGHSDRVNCIKFHPFTGSIPEDGPNVATASADK
TVRLWSLNPEYEFQKSIELHGHEDTVHNIDFHPMGQHLASSSADKTWRLWDLTTRQDILV
QEGHAGEVYPLTFQRDGSLLATGDFQGIGLVWDLRTGQNVLSFQGHVKRIISMRFLPNGY
QVATGSDDNTVKIWDIRRKNCVQTIPAHTKLISDVKFIEQPNSSKLLMLTTSYDNKCKIW
GSTGETGDWIVLRTLNGHENKVTSVNMTKDLKYVITTSFDRTFKLWTPKQVY