Identifiers and Description

Gene Model Identifier

Contig413.1.g100

Standard Name

PRP3a

Aliases

Contig413_1_g100

Description

pre-mRNA processing factor 3 (PRP3)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08572 ) pre-mRNA processing factor 3 (PRP3)
  • ( pfam06544 ) Protein of unknown function (DUF1115)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005999604.998071612500574e-77hypothetical protein
SGDYDR473C1.9993007828132465e-27PRP3 SGDID:S000002881, Chr IV
from 1405854-1404445, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig413.1.g100(coding)
ATGGGGAGAAGTGGAACCCAGCAGCGCTCAGGTTTCTCTGGTGTCGCTACATTCCAAAAC
TAAAACGCTGGTGCCAACTAAATTTAAGATAGCTAGAGAAGTTAACTCAATCCTGTGAGA
AATGAAGTTGAGGAACCTGAATCAAAACCAAAGCAAGTGTTTTTAGATGAGCAAGGTAGA
CTGATTGATGAAAATGGAAACGTTCTTAATGTTAAGTAAGCGACTGAATTAAAGATCAAC
CAGAAGAGTCAGAAAGACAACAAAGTAAGAGACTTGTTAAACATGAAAAAGTATGGGCAA
GCAACTTCATCAGACATACTTTCAAAGAGAAAATTTTTCGATTCTTCTCTCGATGTTTAG
TATAACAAGAGAGACAAGAAAAAGAATGGAGCTTTTAATTTCGTTGAGGAAGGTGTTTTC
ATTAAACGAGCTGAGCAACTGAGGAAAAAGTAATTATTGGAAGAATATGAATTAAAGAAG
GCAAATGAAGGTGGTAGAGGCGAGGAGAGCAAGGATGGTGACTAGATGGATATGTCTATA
GACAAAACTCAATCATCCTCTGCAAATAATGAAAGAAATGACGGAAAGATTCACCTCAGA
AAGACTGTGAACCTAAAACCATTAGATCCTATTCCAGACTTTGAATGGTGGGATGCTGCA
ATTTTAAATCCAACTGAAGATCAAAGTATCATCCAAAGGAGACTAACTGGAGAGATAGTT
GAAGACACAGATATTTTCATAGATAAGATAACTCATTATATTCAGCATCCAGTTCCTCTA
AGGAATGAGTATGTGGAGAACATAAATAAAATGACAATTCCAGTTCATTTAACTGACAAA
GAAAAGAAGCGCCTAAAAAAACTCAAACGTGCAGAAAAAGAAAAAGATAAGTAGGAGAAA
GTTAAACTTGGCCTGATGCCTGCTCCTTTACCTAAAATTAAACTCAGCAATTATATGAAA
GTATTAGGAAAAGAAGCTATTGCTGATCCTTCTAGAGTGGAACAACAAGTTAAGAGACTC
GTAGATGCAAGGCTTGAGTAGCACTTAAAAAAGAATGAAGATAACAAACTCACAAGAGAC
TAGAAAGAAGCTAAAATGAAAAGAAAGCATGAACGTGATATTGTTAATAACGAAGTCAGA
GTAGCTTTATTCAAAATAGACAGACTTACTTAGCCTCATCTAAAGTTCAAAGTTGACATG
AATGCTTAGTAATTTCACTTAGGTGGATTCTGTTTTATTGCAGATTACAACATGGCCCCT
GCTGACTTGCCTAACTTAGTTCTTATAGAAGGTGGTCCTCGTGCTATAAAAAAATATAAA
CGTTTAATGCTCAGAAGAATCAAGTGGAATGAGAAGTCTAAGAAGAAGCAGACTCAAAAC
CAAAACGATGAAGACCCTGATACTTAAATGCAAATTGACCAGTAGAACTAAATTGATGAA
AACGAAGACATAGATGAAGTCAAAGAATCTCTAGACAAAAAGTGTTTCTTAGTCTGGGAA
GGTGTAGTTAAGAAGAAAAGCTTTGAAAGATGGAGAGTTGTAGACATTAGAAGTGAAAAT
GAAGCTAAAAGATTACTCGGAGAGAAGGGTTGTGAGCATTACTGGAGTATGGTTGCTAAC
TTTCATCCTGATAGAGCTGAAGGGGAAGATCACTAAGCACTTGAGAAGGTATTGATGTGA


>Contig413.1.g100(protein)
MGRSGTQQRSGFSGVATFQNQNAGANQIQDSQRSQLNPVRNEVEEPESKPKQVFLDEQGR
LIDENGNVLNVKQATELKINQKSQKDNKVRDLLNMKKYGQATSSDILSKRKFFDSSLDVQ
YNKRDKKKNGAFNFVEEGVFIKRAEQLRKKQLLEEYELKKANEGGRGEESKDGDQMDMSI
DKTQSSSANNERNDGKIHLRKTVNLKPLDPIPDFEWWDAAILNPTEDQSIIQRRLTGEIV
EDTDIFIDKITHYIQHPVPLRNEYVENINKMTIPVHLTDKEKKRLKKLKRAEKEKDKQEK
VKLGLMPAPLPKIKLSNYMKVLGKEAIADPSRVEQQVKRLVDARLEQHLKKNEDNKLTRD
QKEAKMKRKHERDIVNNEVRVALFKIDRLTQPHLKFKVDMNAQQFHLGGFCFIADYNMAP
ADLPNLVLIEGGPRAIKKYKRLMLRRIKWNEKSKKKQTQNQNDEDPDTQMQIDQQNQIDE
NEDIDEVKESLDKKCFLVWEGVVKKKSFERWRVVDIRSENEAKRLLGEKGCEHYWSMVAN
FHPDRAEGEDHQALEKVLM