Identifiers and Description

Gene Model Identifier

Contig8928.0.0.g17

Standard Name

PRP39

Aliases

Contig8928_0_0_g17

Description

Suppressor of forked protein (Suf)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003773300.000005998506718272351hypothetical protein
SGDYLR117C0.000019995566179747357CLF1 SGDID:S000004107, Chr XII
from 384534-382471, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8928.0.0.g17(coding)
ATGCAAATATTCTTGTCAGCTAAAACAAAATTGCTGAAGCTCAAGAATGGTAACTATGAG
AAGAGTTTGAGATATAATTCAGCATAAGTTGAGCTCTGGAAGAGATTCGTAGATTTTGCT
ATGGAAATTCATTATTTCACTAACCAAGATGAAGAAAAATGTAAGCAAATTATGGAGAGA
GCAATTGATAACGCTGGTCAACACATGAAGGGAGCAGAAATATGGACCAAATACATTGAT
TTCGAGATGACTTTAAATCATCTTGGCTTTGTGAACTTGCTATGCTATCTCTCAGCAAGA
ACTCCACTCTTAAATCACGAAGATATCGAAAGAAAGTACACAGACATCATAGAGTCATTG
TATGAGCAAATCGTAGAAGATGTCTAGAAGGAGGATTTTGTGGTCCCTGACAAATATAAA
CTCAAATAAGAAGAACTTGCTAAAATGATGTTTGAAGAATGCAAAGGTGACAAATTTGAA
TTTAAGCAGAAAATCTAAAACTTATCTTAAGAGACTAAGAGCAGAGTTGAAGCAAGACTC
GTCTTTGAAGACCAAATCATGAACATTTGGCAAAATGGCAGACCCTTAGAAGAGGAGAAA
GAAGTCTGGATTGAATATATAAAGTTTGAGATCTCACAGGGAATGCAAAAGAGAGCAAAG
CTTTTATATGAGAGAGGATTGATCTCATTAGATAAGGATCGCCACTTCTGGATATCTTAC
ATTCAATTCCTTGAAAAGAATATTAAAGATCCTCAACTAGCTAGAGTCAAATTTGAAAAT
AGAATCAAGAACGCTGATAAATTCGAAGCAGTAGACTTTATGATTGAAAATGCTATGTTT
GAAGAGGAGCAGCAGTCAATTTAAAAGGCAAGAAAGATTTACGAGACACTTTAGAATGAA
ATAGCACCAGATTATATCAAGAGTTTAATGGCTTTTATAAACTTTGAAAAGAGACAAAAT
AACATCGAGAAGGTCAAGGAGCTTTATTTTAGAGCTTACACTGTATATCTTTAAAAGAAC
CAAGTTGAGACTGTTTCATATATTGTCATTTAATATGCGAGGTTCTTGGCTTTTAAGTGC
GCTGATCCTAACAGAGCGGTTGAAATCCTAAATTAAGCTGTATAAAAAGCAAGAGGCTCC
AAGATGCTCTATTTGAGTTATGTAAACTTCCTGAAACACATGGAAGGAGTTATCCCAGAT
GTCTATTAAAAAGTAGTTGCTGTATTTGAAAAAGGCCTAGATGAGACTTAAAGTGGGTTG
AGCTTAGATGATAAAGCTGAGTTAGCAAGATTCTATTTCGAATATCTGAATGAAAACTGT
ACTAGCGTAAATCTTTTAAGAAACACAGAGCAAGTCTTGAAAGAGAGAGGTTTATTGTAT
GGTATTAAAAAGCAATTAGTTCAATAAGAAATTCCACAAAACTCTAATAATGGGGTTTAA
CTGCAGGTAGACTAGACTATTGGGGGAGCTTAATTCAATGGAGACATTTCATTGGGAAAG
AGAAACTAACCTGAAAATGGTCATTAAGGAGATGTTGACCAAGAATAAGATAAGAGAATT
AAAAATCAGTGA


>Contig8928.0.0.g17(protein)
MQIFLSAKTKLLKLKNGNYEKSLRYNSAQVELWKRFVDFAMEIHYFTNQDEEKCKQIMER
AIDNAGQHMKGAEIWTKYIDFEMTLNHLGFVNLLCYLSARTPLLNHEDIERKYTDIIESL
YEQIVEDVQKEDFVVPDKYKLKQEELAKMMFEECKGDKFEFKQKIQNLSQETKSRVEARL
VFEDQIMNIWQNGRPLEEEKEVWIEYIKFEISQGMQKRAKLLYERGLISLDKDRHFWISY
IQFLEKNIKDPQLARVKFENRIKNADKFEAVDFMIENAMFEEEQQSIQKARKIYETLQNE
IAPDYIKSLMAFINFEKRQNNIEKVKELYFRAYTVYLQKNQVETVSYIVIQYARFLAFKC
ADPNRAVEILNQAVQKARGSKMLYLSYVNFLKHMEGVIPDVYQKVVAVFEKGLDETQSGL
SLDDKAELARFYFEYLNENCTSVNLLRNTEQVLKERGLLYGIKKQLVQQEIPQNSNNGVQ
LQVDQTIGGAQFNGDISLGKRNQPENGHQGDVDQEQDKRIKNQ