Identifiers and Description

Gene Model Identifier

Contig7238.0.g67

Standard Name

PRP28

Aliases

Contig7238_0_g67

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam04133 ) Vacuolar protein sorting 55
  • ( pfam01346 ) Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
  • ( pfam10243 ) Microtubule-binding protein MIP-T3

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009916209.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYDR243C9.99679536751975e-103PRP28 SGDID:S000002651, Chr IV
from 950284-948518, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7238.0.g67(coding)
ATGAGTCTTGCTGGCAATCCAATTCTGGCGAAACCCAATCATTTGAATGGGACAACACAA
GCAAATAATGAACCTCCAAAGCCAACTTTCATGACAAAAAAGCAGAGAGAAGAGTTGAAA
AGAAAATAAGAGGAGGAAGAACAATAAAAAGAGTAAGAAAAATAGCGAGAGATAGAGAAA
AAGCGTTTGGAGTTTTTGAATGCTTAACAGAAATCATGTAGAGATAAAGATAGAGGTGAT
AGGTATGATAGGGACCGTAGATCGAGAAGCAGGTCTTACGAACGAGACAGAGGAGACCGT
AGAAGGGGAGAAGATTATGGTCGTGGCGAGAGAGACCGCGAAAGAGATCGAGATAGAAGG
AGAGACGACAAAGATCGTGATCAAAAAGATGGATCAAGGAAAGATGAAAGAAAGGAAAAA
GAAAAGAAATATCTTATAGAGGACAGAGAGGTTGATTAGATAAAGGGGCAATATCTTGGT
ATAATAAAAGAGAAAAAGAGAGTAATTAAGCCAAGTGATAAGTTTAAGTAAGTCTTTCAT
TTTGCATGGGATGCGAGTGAAGACACTTCAAAAGATATCAACCCACTCTACAATCAAAGA
CATGATCCAAAGTTATTGTTTGGTAAAGGGCATCTAGGTGGTCTTGATCTTGAAGCATAA
GCAAAGTAGAATGGAGCAAAAGTAGAAGGCAAATAAGTTGATAAATACATGGGCTAGAGA
AGCTCTCTTGAAGAATATCTAAAGAAACCATTGGAAGAAATGACTGAGAGAGATTGGAAG
ATATTTAGAGAAGACTACGATATAATGAGAAAAGGAGGCAGGATTCCTAATCCTGTTAGA
AGTTGGGATGAAATTGAAAACCTACATCCTATATTGAGAGACAATATCTCGGAATGTGGC
TATCCCAGACCAATGCCGATTTAAATGCAAACGATACCTATCGGCATGAACTTTAGAGAT
CTTATTGGTCTGGCTCCAACTGGTTCTGGTAAATCAGCTGCTTTCCTTATACCCCTAGTT
AATTTCTTACTTAAAATGCCTCCAATCAGGGAAGAATTAGTTTAAGATGGACCTTATGCT
ATTATTATGGCTCCAACTCGTGAACTCGCTATTCAAATTGAAAACGAGTTTAGAAAGTTG
TCAGCTGATTCACATTTAAGATCTATCGTTGTAGTCGGTGGAAAGAGTGCTGAAGAGTAG
GGTTCTAGCATTTCAAGAGGAGTAGAAGTTGTTATAGGTTCTCCTGGAAGAATTGAAGAT
CTAGTCAAGAGAAGATATTTAGTTCTGAATTAATGCTATCATGTCATTCTTGATGAGGGT
GATAAAATGATTGACTTAGATTTGGAAGAATCAGTTAACTTTATCCTAGAATCAATTCCA
TCAAATTTGTAAAAGAGTGATAAGGAGAGAGAAGTTATGGAATAAGAGAATTAAATGATT
AAGGGATAAAAGTTTATGAAGACCTTTGTCTTGTTTTCAGCAACTATGCTTCCACAGATT
GAAAAACTAGCTAGAAAGTACCTAAGATTCCCAGCTTTTATATCAATTGGAGAACCAGGA
GGTGGTAAAAAGGATATCGAACAAAGAATTGAAATGATGTCTGAGTCTCAAAAAAGAAAT
AGACTCTAGTAACTTTTGGATAAATATAGAGCTCCACCAATTCTAATCTTCGTGAATTAA
AGAGCAGACACAGAACATCTCTCAACTTTCCTTACAAAAGTTGGCTATAATGTGGGTGCC
TTACACGGTTCCAGGACACAGGAGTAGCGTGAATAAGCCCTAAATTCTTTGAAAAAGGGA
AGTCTAGATATCTTGGTGTGTACCAATGTCGCAGCTAGAGGTCTTGATATTGACTGTGTA
ACACATGTCATCAATTACCATGCTCCCTCAAACATCGTAGACTACATCCATCGTATTGGT
CGTACTGGTAGAGCAGGCAAGAAGGGTATGGCTACAACTTTCTTGACACCAGGGGATGAA
GGAATATACTATGACTTGAAGAAGTTCTTGTAGGATAACGACTAGCATGTACCTGCTGAA
TTGGCAAATCACAACGCTGCTAAGTTCAAGGGTGGCGTTGAAGCTATAGGTGGTGCATTA
GGTGGGAACACAGTACCAACCAGCACATAAATGAATAAAATGATATGA


>Contig7238.0.g67(protein)
MSLAGNPILAKPNHLNGTTQANNEPPKPTFMTKKQREELKRKQEEEEQQKEQEKQREIEK
KRLEFLNAQQKSCRDKDRGDRYDRDRRSRSRSYERDRGDRRRGEDYGRGERDRERDRDRR
RDDKDRDQKDGSRKDERKEKEKKYLIEDREVDQIKGQYLGIIKEKKRVIKPSDKFKQVFH
FAWDASEDTSKDINPLYNQRHDPKLLFGKGHLGGLDLEAQAKQNGAKVEGKQVDKYMGQR
SSLEEYLKKPLEEMTERDWKIFREDYDIMRKGGRIPNPVRSWDEIENLHPILRDNISECG
YPRPMPIQMQTIPIGMNFRDLIGLAPTGSGKSAAFLIPLVNFLLKMPPIREELVQDGPYA
IIMAPTRELAIQIENEFRKLSADSHLRSIVVVGGKSAEEQGSSISRGVEVVIGSPGRIED
LVKRRYLVLNQCYHVILDEGDKMIDLDLEESVNFILESIPSNLQKSDKEREVMEQENQMI
KGQKFMKTFVLFSATMLPQIEKLARKYLRFPAFISIGEPGGGKKDIEQRIEMMSESQKRN
RLQQLLDKYRAPPILIFVNQRADTEHLSTFLTKVGYNVGALHGSRTQEQREQALNSLKKG
SLDILVCTNVAARGLDIDCVTHVINYHAPSNIVDYIHRIGRTGRAGKKGMATTFLTPGDE
GIYYDLKKFLQDNDQHVPAELANHNAAKFKGGVEAIGGALGGNTVPTSTQMNKMI