Identifiers and Description

Gene Model Identifier

Contig11787.0.g47

Standard Name

PRP24

Aliases

Contig11787_0_g47

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007564502.000620012690291e-23RNA binding protein
SGDYNL175C0.0000000400154582995175NOP13 SGDID:S000005119, Chr XI
V from 308612-307401, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11787.0.g47(coding)
ATGATCAAGAGTGACTAAAGAATCGACGATCTTCCTGGAAACCAAAACTTTTCCGCCTTC
TAATTGAAGGAGTTGAAATAAAGAATCGTTTACCTTGAAAATTTCCCATCAAACGTTGAA
GAGAAGAATATCAAAAAGGCTTTCAGAGAAAACGGAGAGATTGAGAAAATCTGGCTTAGA
GTAATGCCAGAAAAGGATTCACAAAAGAAGCAAGCTTATCTCTTATTTAAGAACAAGGAA
GACGCCTTAAATGTTGCTACTTTGATAATGAAACATAAAATTGATGGGAGTGACTTGGAA
GCTAAATCAAATAAAGTTAGGAAAAATCTAGCAACTGAGGGAGACAAATCTTAAGACATC
AGTCTTAATGATTATGAAACAACCATCTTTATTAGAAATGTGCATCCCAGACTAAGCGAG
GACGAGCTTAAAACTCATTTCTAAGAGTGTGGTCATGTAGTTAGTATTAACTTGGTAAAA
GACAAGACAAATTAATTAAATTAAGGTATTGCATATGTGAGATTTGCATCAAAAGATGAA
ATGAATAACGCTATTAAATTGAAAAACAAGACAAAACTTAAGGAAAGACATCTTAAAGTT
ATGAGAGCTATGGATTTGCATAAAAGCTCACCAGAGGAAATTTTGAAAAGAAGAGAGGAA
AAACTACAAAAGAAAATTGATCAGTAAGAGCTAAGAAATGAAAGAACTCATTTAAAGGAC
GAGCAGGCTGAGTTTTTTATTCAAGCTAGAAAGAATCTTAAAGGTAATGGACATCTAGAT
AATCTTGATATGGGTAATAACATATCAGCGAGGGGTAAGAAAGAAAAAAAGAGAGTCCTT
GAATAAATGATAGAAAGCAGAGATAAAAAGACCAGCAAACATTAAAAACATAAGAATCAA
ATTTTCAAGCCAGTGCCAACTCTAAATGAAGCTCACAGAAAGAAGAGAAAGCTTAGAAAG
GCTCAAAACATGAAAAAGTTCACTAAAATCAGAATAAAGAAAGCCCCAGTATGA


>Contig11787.0.g47(protein)
MIKSDQRIDDLPGNQNFSAFQLKELKQRIVYLENFPSNVEEKNIKKAFRENGEIEKIWLR
VMPEKDSQKKQAYLLFKNKEDALNVATLIMKHKIDGSDLEAKSNKVRKNLATEGDKSQDI
SLNDYETTIFIRNVHPRLSEDELKTHFQECGHVVSINLVKDKTNQLNQGIAYVRFASKDE
MNNAIKLKNKTKLKERHLKVMRAMDLHKSSPEEILKRREEKLQKKIDQQELRNERTHLKD
EQAEFFIQARKNLKGNGHLDNLDMGNNISARGKKEKKRVLEQMIESRDKKTSKHQKHKNQ
IFKPVPTLNEAHRKKRKLRKAQNMKKFTKIRIKKAPV