Identifiers and Description

Gene Model Identifier

Contig20351.0.g75

Standard Name

PRP21

Aliases

Contig20351_0_g75

Description

Surp module

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000137505.000040196085687e-64Surp module family protein
SGDYJL203W0.000019995566179747357PRP21 SGDID:S000003739, Chr X
from 53341-54183, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20351.0.g75(coding)
ATGACTGCAATGTTAGACACTTCAATGGACAACGATTTCAATGACCACCAAGAAGAAGAG
CAGCACAAAGCCAGAGTGATCATCCCACCCCCTGATATTAAATCAGTCATCGACAAGACA
GCCAATTTCGTGGCTAAAAACGGTGCTAATTTCGAAGCTTTAATCTTGAAAACAGAGCAG
AACAACTTGAAGTTTAACTTTCTGCGGCATTTAGACGACCCCTACAGGCCTTACTACATG
CAAAAGATTAACGATAATTTGGGTATAAGTGCCTAATCTGAATTGGAATAGAAACAGAAA
TAAGTCAATGCACTTCAAACACCATAAGATTAATAAATAGATGGAGCTGTGAACTAGTAA
GAAATGGTTGAGGAAGTTAATGGAGATGGTTTAGGCAATTTGCAAGAAAATAATCATGTG
GATTAATAACATCAACATGTTGCTCCTGTTTCTGCAGTGCAGATGCACTCTGTTGTCAAG
GAGAAAGAATACTAACGATAATTGAGACAAATGATATTTGGAGATGTGGATGAGCGCAAG
AAAGTTGGGGATATCAAGCCACCACCCACAGATAACTTCAGCATTAGTCACCCAATCCTT
GCGAATATCGATCATGAAGTAATAAAACTCACTGCCTAATTCGTAGCAAGAAATGGCCAG
AAGTTTCTGCAAGGCCTGACAGAGAGGGAAGCCCGCAACCCCTAGTTCGATTTCTTGAAG
CCCACGCACGGCCTGTTTGGCTACTTCACTTAGCTGGTTGAGTCCTATAGTAAAGTGCTT
ATACCAAGGAATGAGCAGCTCTCGAGACTTAAGAGATTTGCTCAAAAAGGCCAAGAAGGA
GGGCTTGAAATTCTCAAGGCAGCTGGAGACAGATACTTGTGGGATAAAATCTAAGAGGAA
GAATAGAAACTCAGAGCAGATCATGAAATCTTACATGGTGTGGATGGTAGTCTAACTGAA
GAGCAAATGCAAATAGAAGCCATAGATTGGCATGAATTTGTGGTAGTTGAAAAAATTGAT
TTGTACGATGACGAAGAGATGAAGGAAATTGAAGATGCCGAGCTCGAAGAGTAGAAAGAG
CAAGAGAAAATTAAAGAGCAGATTAAGAAGCAAATAGAGGAGAATTAATCAATTATGAGC
ATGCCACCGGATGGTCTTGCTCCAGATACAAAACCTGACATTTCTAAAGCTCAACAAATA
AAACTTCCACCCTTACCATCTCTATCCCAAACTCCTAACGAAGTAGTTGTGTCCACAGCT
CTTGACTCTGAGATGAAGGTCAAGAAAAATTACCAACGTGGAAATGAAAAAACTGCTGGT
GGAGTTAGTGCAGGAATAGGCGCTTAAAAATGTCCAAAATGTCAGTAAGAGATCCCTCTT
TCAGAATGGAAAGAACACATGAAACTAGAACTTATGGATCCAAAGTGGAGAGAAGAAAAG
CAACGTAGGGAAGAGAGAGCAAAACTTAACACTTATGCAGATGGAGATGAAATTACCCAG
AATTTGAGAAGATTTGCACAAGAGAGAAGAGATGTTTTTCCTAATGCTGGTTAAGCATAA
AGCTCAAGTACAAGTTAGACTGTACAAAGCAATACAATTAGTGCTGGAGCTACTGGACAA
GGGGACCAACAGAAAATTATTTGGGATGGTCAGGCTACCGGAGTCACAAGAACAACTGCA
AACATTGCAATGCTCTAACATCAACAAGCCAGAAATTTAACTGAAGCATTTGAGATTAGA
GGTCAATTGGATCCAAAGTCTATGGATAAACTAAACAAGGCTAATAATCCTGTACCTACT
GTCAAAAACATCTAAAATGCCATGCTTTCTAAAGAGTAAATGAGACAGTAATAAGCTGGT
TAAATTTCAAAGAAACCTATTGAGGATGATGAGGATGAAGCATTAAACTATTTATAAACA
TAACTTAGATCTGAGGCTGAGTGGCTTCGTTTATTCCCAGGAAAGCTTAACCTTAAAGTT
CGTAATACGGTTACATCTGATGGTAATTAAATAATCCCATTAAATGTCGACTCAAGAGTT
ACAATTGGAGCTCTGAAAGAAAATCTCAACTCACTATTGAATAATTTCGCTCCCATCTCC
CATTTGAGACTCCGTGGTATGAAAAATCTACCAATGAAGGATAACTTAACTCTTGCTTTT
TACAATATACCAGATGGTGCCTAACTTGAACTTGGCTTGAAAAATAAATGA


>Contig20351.0.g75(protein)
MTAMLDTSMDNDFNDHQEEEQHKARVIIPPPDIKSVIDKTANFVAKNGANFEALILKTEQ
NNLKFNFLRHLDDPYRPYYMQKINDNLGISAQSELEQKQKQVNALQTPQDQQIDGAVNQQ
EMVEEVNGDGLGNLQENNHVDQQHQHVAPVSAVQMHSVVKEKEYQRQLRQMIFGDVDERK
KVGDIKPPPTDNFSISHPILANIDHEVIKLTAQFVARNGQKFLQGLTEREARNPQFDFLK
PTHGLFGYFTQLVESYSKVLIPRNEQLSRLKRFAQKGQEGGLEILKAAGDRYLWDKIQEE
EQKLRADHEILHGVDGSLTEEQMQIEAIDWHEFVVVEKIDLYDDEEMKEIEDAELEEQKE
QEKIKEQIKKQIEENQSIMSMPPDGLAPDTKPDISKAQQIKLPPLPSLSQTPNEVVVSTA
LDSEMKVKKNYQRGNEKTAGGVSAGIGAQKCPKCQQEIPLSEWKEHMKLELMDPKWREEK
QRREERAKLNTYADGDEITQNLRRFAQERRDVFPNAGQAQSSSTSQTVQSNTISAGATGQ
GDQQKIIWDGQATGVTRTTANIAMLQHQQARNLTEAFEIRGQLDPKSMDKLNKANNPVPT
VKNIQNAMLSKEQMRQQQAGQISKKPIEDDEDEALNYLQTQLRSEAEWLRLFPGKLNLKV
RNTVTSDGNQIIPLNVDSRVTIGALKENLNSLLNNFAPISHLRLRGMKNLPMKDNLTLAF
YNIPDGAQLELGLKNK