Identifiers and Description

Gene Model Identifier

Contig22546.0.g71

Standard Name

PRP19

Aliases

Contig22546_0_g71

Description

Prp19/Pso4-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001610503.9989468726312675e-65hypothetical protein
SGDYLL036C0.0000000000000030004923591262316PRP19 SGDID:S000003959, Chr XI
I from 68256-66745, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22546.0.g71(coding)
ATGTCAGTCAGTACTTGCGCTCTATCAGGTCTCCCACTTGAGAATCCAATTGTGTGCACT
AAAACAGGACATGTATTTGAGAGAGATTTGATCAAGAAACACCTAGATCACACTGGCCAG
TGCCCTTTGACAGGCGTAGATTTGAATTTCGATCAGGACTTTGTTGAGTTGAAAGTGTCA
TAAGCTGCACTTCCCAAACCCATAGTTGCAAACAACGTCCCAGGTATACTTCAAATGTTT
CAATCTGAGTGGGATAACGTGATGCTTGAAGTATTTTAGCTTAGAAAGAACTTGGAGCAA
ACTAGAAGAGAGCTTTCTCAAGCACTGTATCAACATGATGCAGCATGCAGAGTGATTTGC
AGATTAATGAAGGAGAAGGAAGAACTGCAAAATGTGCTCTCATTGACGACCGATAAGATG
GAACAGTACAAGAGTGAATTGGCATCATAAGTTGTCTAAGGGGGTGCCAGTGGACTAGGC
TACGTTAGAGAAGAGAAGTAGGATGAAGGTATGTATCCTGAATTAGCTGCAAGAATGGAG
AAATTATCTAAGCAATTACAGGAGTAAAGAAAAAAAGATAAAGCACCAGCTAATTATCCA
AAGCTTGAAGACTACAAAACACTCAAATAAGCTGGATCATTCCCATTACACGATAGCACT
AAACCAGGTATTTTAGATCTTGACATTCATCCAATTAATGATACTTTCATTTTATCTGGA
GGAAGAGACTCCAAAGCAATATTGTTTGATCGTAAGGAGGGTCAAATAATTAAGAAGATT
GACGTCTTTGATCAAAAGAAGAAACCTGGAGTTACTGTTGCAAAGTTTGTACCAGGATAA
AATGATTTATACAGCATCTTTGGTTCATCTGATGGTCATGCTGGGGTTTGGCTTCTCGAT
TACTAAAATGAAAAATACTCAGAGAAATACTCAATTTAAGGTCATAATGGTGCTATAACT
GGTGTAAGTTTCCAGCCACTTAATGAGCATGCAGTCATCAGTTCAAGAGATAAGACTTGG
AGTTTGCACAACCTCTTCCAAGGAGTCAGATTAACAACTATGAAGGAAGATGAAGAAGTC
ACTTCCATTGAATTTCATCCTGATGGTCTTTTGATGGCTTGTGGTCTTAAAAACGGCATT
ATTAAGATTTACGATTTTAGATAATTGAAACAAATCATGGAACTTAAAGATTTTGCAGGC
TATGGAGAAGTGAACTCACTTTCATTTTCAAACAAAGGAACTTCATTCGCTGCATCATGG
TCAAACATGAAGGATAGTAAAGTTATTAACTTGAGAAAGATCCAGGAAGTTTAATCACCA
GTTAATCATTTCGCTGACACAACTACCCATTCAGTTCACTTTGACACTTATGGAAACTAT
CTCTTAAGTGGTTCTGGAAATGGCATCAATATTTATGGAGGAAAGACAATGAGTGAACCT
ATTCATAGTATGATAGCACATGAAGGAGTTGTTAATGTCGCCAAATTTTCAGCTAATGGT
CAAATGATTGTAACAGGAGGAGAAGACAGATTCCTTAAAGTTTTTACTCTGTGA


>Contig22546.0.g71(protein)
MSVSTCALSGLPLENPIVCTKTGHVFERDLIKKHLDHTGQCPLTGVDLNFDQDFVELKVS
QAALPKPIVANNVPGILQMFQSEWDNVMLEVFQLRKNLEQTRRELSQALYQHDAACRVIC
RLMKEKEELQNVLSLTTDKMEQYKSELASQVVQGGASGLGYVREEKQDEGMYPELAARME
KLSKQLQEQRKKDKAPANYPKLEDYKTLKQAGSFPLHDSTKPGILDLDIHPINDTFILSG
GRDSKAILFDRKEGQIIKKIDVFDQKKKPGVTVAKFVPGQNDLYSIFGSSDGHAGVWLLD
YQNEKYSEKYSIQGHNGAITGVSFQPLNEHAVISSRDKTWSLHNLFQGVRLTTMKEDEEV
TSIEFHPDGLLMACGLKNGIIKIYDFRQLKQIMELKDFAGYGEVNSLSFSNKGTSFAASW
SNMKDSKVINLRKIQEVQSPVNHFADTTTHSVHFDTYGNYLLSGSGNGINIYGGKTMSEP
IHSMIAHEGVVNVAKFSANGQMIVTGGEDRFLKVFTL