Identifiers and Description

Gene Model Identifier

Contig22582.0.g105

Standard Name

PRP17

Aliases

Contig22582_0_g105

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004945705.00051218414862e-165hypothetical protein
SGDYDR364C8.000204209547377e-76CDC40 SGDID:S000002772, Chr IV
from 1204210-1202843, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22582.0.g105(coding)
ATGCCAGAAGCAATTGATCTTGCTCCAGATGTAAACATAATAGACTTACAGCTATAAAAG
TTCACACAGGAAATTAATCATTTTAAAAATACAAATGAGGTAATAACCAAAAAGAATCAT
TTGAATGGAGTAATAGAGAAAATTAACATTAATGAGGGCAAGTTTCATGAGCAATTTCAT
AATTTTGAAAACTTTGGTTATGCTGCAAACCCCTCTGATAATGCTGGTGTTTCTGGAGGG
TCTAAATAAACTGTGTTTTCAAATACTGTTAATAAAATTGATTTGGATGCAAATGTGGAG
AATGGTTTGTCCAAAAGTAGAAAAGAGTACAAAAAAGAGATGAAGAAAAAGAGGCAAAGA
ACTGGAGATCCTGCAACAGGGGAGTTTATGGGACCATGGGCTATATATGATGGCATGGAG
CAATTCAAAACTTAGAGAGCTGATTTAGATGAGGAACAAAAGGAGATGATGAAGAGGTAT
GAGGAGATGCGCAAAGAAAGAATAGATGAAAACAAGCCAAACAGAGGTGATAGGGAATAC
GCTGAGAGTGAAGTCCACAGAGCAACTTCGATTTATCATGGAGTGAATGGAGATTATGGT
GCTAATAAGGGTTTCGTTGACCATCCATCATACATGAGACCAAAGGAACATGCTTGCTAC
ATTCCAAAAAAATGGTTGCATACCTTCGTTGGGCACAACAAAGGAGTCCAAAAAATTGAA
TTCTTCCCTAAATATGGACACCTCCTCTTATCAGCAAGTCATGATGGCACAGTCAAAATA
TGGGATGTTATGACTCACAGGAAATGCTTGAGAACTTACATGGGCCATACCAAAGCTGTG
AGAGATATCTGTTTCAGTAATGATGGGCGTCGCTTCTTAAGTGCTGGATTCGATAGAGTA
ATTTAATTATGGGACACTGAAACCGGAAAAGTTATAAGAAGTTTTACTAATAGAAAAACA
CCGTTTTGTGTTAAGTTTCACCCATCTGATGACAAGTAAAATATATTCTTAGCAGGTTGT
GCAAATAAAAAGATTCTGTAATACGATACAAATTCAAGTGAGATTACTCTTTAATATGAA
GAGCATCTAGGTTCAATCAATACAATCACCTTTATTGAAGGTGGGCGTAGATTTGTCTCA
ACAGCTGATGATAAAAAGATCTTCTTATGGGAGTTCGGAATTCCTGTAGTAGCCAAACAT
ATTAGTGAACCAGATATGCAGGCAATTCCAGCAGCTACGATGCATCCAAATGGCAAGTAT
TTCGCTGGATAGTCAATGGATAATAAAATAGTTATCTACGATTGCAAGGGCAACTTCAAG
ATGAATAGAAAGAAGAAGTTCAGTGGACATATCAACTCAGGGTATGCTTGCGGTTTGAAC
TTCTCACCAGATGGGTAATTCTTGGCGTCAGGAGACTCTGATGGTAAATTGTGGTTCTGG
AACTGGAAGTCTTGCAAGAATCTGAGAACAATGAAAGTTCATGAGGGAGTTTGTATTGAT
GCGAAATGGCACCCCCTTGAACCATCAAAAGTAGCAACTTGCGGCTGGGATGGCACTATA
AAGCTATGGGACTGA


>Contig22582.0.g105(protein)
MPEAIDLAPDVNIIDLQLQKFTQEINHFKNTNEVITKKNHLNGVIEKININEGKFHEQFH
NFENFGYAANPSDNAGVSGGSKQTVFSNTVNKIDLDANVENGLSKSRKEYKKEMKKKRQR
TGDPATGEFMGPWAIYDGMEQFKTQRADLDEEQKEMMKRYEEMRKERIDENKPNRGDREY
AESEVHRATSIYHGVNGDYGANKGFVDHPSYMRPKEHACYIPKKWLHTFVGHNKGVQKIE
FFPKYGHLLLSASHDGTVKIWDVMTHRKCLRTYMGHTKAVRDICFSNDGRRFLSAGFDRV
IQLWDTETGKVIRSFTNRKTPFCVKFHPSDDKQNIFLAGCANKKILQYDTNSSEITLQYE
EHLGSINTITFIEGGRRFVSTADDKKIFLWEFGIPVVAKHISEPDMQAIPAATMHPNGKY
FAGQSMDNKIVIYDCKGNFKMNRKKKFSGHINSGYACGLNFSPDGQFLASGDSDGKLWFW
NWKSCKNLRTMKVHEGVCIDAKWHPLEPSKVATCGWDGTIKLWD