Identifiers and Description

Gene Model Identifier

Contig16336.0.g91

Standard Name

PRP11b

Aliases

Contig16336_0_g91

Description

Zinc-finger of C2H2 type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003436801.0001055852164665e-60spliceosome associated protein
SGDYDL043C0.0000000000019997478866288316PRP11 SGDID:S000002201, Chr IV
from 376480-375680, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16336.0.g91(coding)
ATGGACATGCAAAATAGAGCTGGGTCAAAATCCAGCGCAGTTGCTTCTCAAAGTGAATAA
AATCTACAGCATAAAGAAAGATTAAGACGCCTGCATGTGGAAACTGCTGATGTATCGAAC
GACCCATATATCATGAGAAATCATTTGGGATCTTTTGAGTGCAGACTATGCTTGACCCTC
CATACAAATGAAGCTTCTTATCTTGCTCACACTACTGGCAAAAAGCACTAGACTAATCTG
CATAGACGTCAGCTTAGAGAAAACAAAGATAACAACAACTTACCCCAACCCAAAATCAAA
CTCTAAAAGAAGAACACCATTAAAATTGGAAGACCAGGGTATAGAGTCATAAAGCAGAAG
GACCCAGACAACGGTTAAAAGTCTTTACTCTTTGAAGTTGAATACCCAGAGATAGAGTCA
AAACTTTAGCCTAGATACAGGATTATGAGTGCCTATGAGCAGAAGCAGATCCCTATGAGA
CAATAGCTTTTAAGATTCCGAACCTAGAANGTTGCAAGACCTAAGAATGCTTGA


>Contig16336.0.g91(protein)
MDMQNRAGSKSSAVASQSEQNLQHKERLRRLHVETADVSNDPYIMRNHLGSFECRLCLTL
HTNEASYLAHTTGKKHQTNLHRRQLRENKDNNNLPQPKIKLQKKNTIKIGRPGYRVIKQK
DPDNGQKSLLFEVEYPEIESKLQPRYRIMSAYEQKQIPMRQQLLRFRTQXVARPKNA