Identifiers and Description

Gene Model Identifier

Contig15681.0.g15

Standard Name

PRP11a

Aliases

Contig15681_0_g15

Description

Zinc-finger of C2H2 type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam12874 ) Zinc-finger of C2H2 type
  • ( pfam09732 ) Cactus-binding C-terminus of cactin protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003436801.9998521972819316e-89spliceosome associated protein
SGDYDL043C8.99682777598231e-22PRP11 SGDID:S000002201, Chr IV
from 376480-375680, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15681.0.g15(coding)
ATGGACATGCAAAATAGAGCTGGGTCAAAATCCAGCGCAGTTGCTTCTCAAAGTGAATAA
AATCTACAGCATAAAGAAAGATTAAGACGCCTGCATGTGGAAACTGCTGATGTATCGAAC
GACCCATATATCATGAGAAATCATTTGGGATCTTTTGAGTGCAGACTATGCTTGACTCTC
CATACAAATGAGGCTTCTTATCTTGCTCACACTACTGGCAAAAAGCACTAGACCAATTTG
CATAGACGCTAACTGAGAGAAAACAAAGATAACAATAACTTACCACAGCCCAAAATCAAA
CTCTAAAAGAAGAACACAATCAAAATTGGAAGACCAGGGTATAGAGTCATTAAGCAGAAG
GACCCAGACAACGGTTAAAAGTCTTTACTCTTTGAAGTTGAATACCCAGAAATAGAATCA
AAACTTCAGCCTAGATACAGGATTATGAGTGCCTATGAGCAGAAGGTTGAGACACCCGAT
GATAAATATCAATATTTACTCTTTGCAGCAGATCCCTATGAGACTATAGCTTTTAAGATC
CCCAACCTAGAAATAGATTTCTCAGAAGGTAAATATTTTGATGCATGGGATAAGGACCAG
AGAAAATATACACTCTAAATATTCTTCAAAGAAAAGAAAGTTGCAAGAGTTAAGGCTGCT
TGA


>Contig15681.0.g15(protein)
MDMQNRAGSKSSAVASQSEQNLQHKERLRRLHVETADVSNDPYIMRNHLGSFECRLCLTL
HTNEASYLAHTTGKKHQTNLHRRQLRENKDNNNLPQPKIKLQKKNTIKIGRPGYRVIKQK
DPDNGQKSLLFEVEYPEIESKLQPRYRIMSAYEQKVETPDDKYQYLLFAADPYETIAFKI
PNLEIDFSEGKYFDAWDKDQRKYTLQIFFKEKKVARVKAA