Identifiers and Description

Gene Model Identifier

Contig10294.0.g5

Standard Name

PRMT5

Aliases

Contig10294_0_g5

Description

PRMT5 arginine-N-methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR133C7.000698492250867e-53HSL7 SGDID:S000000337, Chr II
from 504287-501804, Genom...
T. thermophilaTTHERM_002194900.000000030002053728821195hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10294.0.g5(coding)
ATGCCCTTCAAGACTAAAGAGATACCCTACGATTTGAGAGTAGGCCGTGACATCAACACA
GTCTCAAATTTGAAGTCCCTCATCACAGATCAACAATAATTCTTTGACTTTGTACTAATT
GATATCTGCCATGCCCTTAATTTCAGAAATGAAAACACTATAGGAAGCAGAGACATCGCT
CTAACTAGATCTGATACTTCTATTAAGAGTTTCTTCTGGTCAGACTTTATCTTAGCAAAG
ATTAACAGTTACTTCACAGATTGCGATTCCCCCTATGAACATGTGAGATTAAGATCAGAG
GCCATTATTACATAAGAAATTAACTTCTCAATGCACTTGAGCATTCATGCTATTGTCTTT
GATTTACCAAAGTCACCTAGAATTGAAAATTTTGCTAGAATTTTCGATTAGTATTTCCAG
AATGTTCACACTGCAACTAAATTTATTATGAGAATAGAGATTCCTGCTGATTTTAAGCAA
GCTGAGGAAGTTTATGAGAAATATCTTTAGTTCAAGATGCTCTGTGGTCATTACAATGGC
TTATCAGTAATTTTAGCATTTGGAGCAGACTTGCCATCATGGGAACACTTCTCAAAGAGA
TGGATTGGTGAATTAGTCTTCGGAGTACAATTGGATACTAATGCTTTCCTCACTAACCAG
AAGGGTCATCCAGTTCTTTCCAAAGCTCATCAGGAAACTTGCAAGGCCTTAATGAAAAAG
AAAGCCCACTTTATTTTGAAGGGAAAACATCCAAATGATAATTTGGACAGCTACTACCAG
TACTTATGTCACTTGTTCAAGACTCATGATGAGCTTGACGAAGAGGAGAAACTTGAAGTT
TCTTACAGAGATTATCTTCAATCACCCTTGCAACCATTGGCTGATAACTTGGAAGCAGCA
ACCTATGAGACCTTCGAAAATGATACTATTAAGTACGATATTTATGAAGATTCCCTATAC
AAAGCATTCTTGGATAAGAAAAAGTATGGCAGATTTTTCCAGACAAATTCAGAGTTGGCT
AAGCAAATTTCAGACAATGAAAATGTTTAGATGAGTGATTCAACAGGAAACTCACCAGAC
GATCCCATAGTTGTTATGTATTTTGGTGCTGGTAGAGGACCTTTGATTAGAAAAGCAATT
AGTGCTGCAAAGAAAGCTGAAGTTCACATTAAAGTCATTGCTCTCGATAAAAACCCAAAT
GCTATAGTAACTCTGAGAAACATGATTATAGACGAGAACCTTGAAGATAAGGTCACCCTC
TTTGCTGGAGATATGAGAAAAGTGGCAATTAATGATCTTTAGGGCGATATATTAATGAGT
GAACTTCTTGGATCATTTGGAGATAACGAACTCAGCCCTGAGTGCCTGAATCCAACAAGT
AAATACCTTAAGAAAGGAGGTATTTTTGTGCCATTTTCATACACTAATTATGTCGTCCCT
ATCTCAAGTTAGATAATCTGGAATGAAGTGAATGTCTACGCCAGTTCAACAGTCTCTCAG
AAGGTGTCAATCTCCCAACAGCTCTACCCCTTTGAACTGCCCTACGTAGTGAAGATATAC
TCAGCAACTTTCCCATGTGGAGACACAACCCAAGAAGTCTTCACCTTCAGACATTTGCCT
TATCCTGATGACCCCAAGCAAGCTATTTACCTAGAGGGAGAGCAACAACCTATGAAGAAA
TACGATCGCAAGGTGTTCACTTGTGAGTAGGTGCAAGCTTAGATTCATGGATTCGCAGGC
TATTTTACTGCAGAGTTGTATTAAGACATACTATATAGTACTAATCCAGCTTAACATACA
CCTAAAATGCATTCGTGGTTCCCCTTATACTTCCCTGTGAAGGAGCCATTCATTGTGTTC
AAGGGCTAAGAAGTCACAATAAGCGTTTGGAGAAACAATTCTCAAGCTAAAGTGTGGTAC
GAATGGTCAATGAGTGTATTCGACCCCACTCAATAGAAAACTGTCTATACCACACACATC
CACAACATCAACGGTAGAGGTTTCAGTATTGGCTTGTGA


>Contig10294.0.g5(protein)
MPFKTKEIPYDLRVGRDINTVSNLKSLITDQQQFFDFVLIDICHALNFRNENTIGSRDIA
LTRSDTSIKSFFWSDFILAKINSYFTDCDSPYEHVRLRSEAIITQEINFSMHLSIHAIVF
DLPKSPRIENFARIFDQYFQNVHTATKFIMRIEIPADFKQAEEVYEKYLQFKMLCGHYNG
LSVILAFGADLPSWEHFSKRWIGELVFGVQLDTNAFLTNQKGHPVLSKAHQETCKALMKK
KAHFILKGKHPNDNLDSYYQYLCHLFKTHDELDEEEKLEVSYRDYLQSPLQPLADNLEAA
TYETFENDTIKYDIYEDSLYKAFLDKKKYGRFFQTNSELAKQISDNENVQMSDSTGNSPD
DPIVVMYFGAGRGPLIRKAISAAKKAEVHIKVIALDKNPNAIVTLRNMIIDENLEDKVTL
FAGDMRKVAINDLQGDILMSELLGSFGDNELSPECLNPTSKYLKKGGIFVPFSYTNYVVP
ISSQIIWNEVNVYASSTVSQKVSISQQLYPFELPYVVKIYSATFPCGDTTQEVFTFRHLP
YPDDPKQAIYLEGEQQPMKKYDRKVFTCEQVQAQIHGFAGYFTAELYQDILYSTNPAQHT
PKMHSWFPLYFPVKEPFIVFKGQEVTISVWRNNSQAKVWYEWSMSVFDPTQQKTVYTTHI
HNINGRGFSIGL