Identifiers and Description

Gene Model Identifier

Contig15489.0.0.g18

Standard Name

PRI2

Aliases

Contig15489_0_0_g18

Description

Eukaryotic and archaeal DNA primase, large subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04104 ) Eukaryotic and archaeal DNA primase, large subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL045W3.000745802558524e-63PRI2 SGDID:S000001528, Chr XI
from 353493-355079, Genom...
T. thermophilaTTHERM_002437109.002473480287786e-47Eukaryotic-type DNA primase, l
arge subunit fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15489.0.0.g18(coding)
ATGTACGATTCGAATGAAACTTAGGAAAAGATCAAGGACACTGTCTTCAAAATGACTAAA
CAGCATAGAATCGCAATTCAAGTGGCAGCAGGATCTTCATCAGTATATATCCCACCTGAA
AACAGAAGAGAATTCAAGGAAAACGATAATATCTCACATTTCATTTGCAGATTGGCTTAC
TGCAGAACTGAAGAGTTGCGCAAATGGTTCTTAACCCAAGAAGTGAGACTATTCTAAGCT
AGAATGAGTGAAGTCAAAGCTGAAACTATTCAATAATTGCTAGAATTACAGTGCAATATT
AGATACGAATAAGTTAAGGAAGACGACTAGGATTGGAAATAATATGGAGCAAAGATTTCA
TTCAAATTCCTCAAAGCAGAAGAGCGCAGAGCCAATTGTTTCGTGAAGGTTCCATTCAAG
GAGGCAATTTCCCTTGTGAATAGAAGATAAGTATTTTTGCTCAATGGTATTGCTTATGTA
TCAATCAAGGATTTAACTACAATCTTAGGAGCCCACTTTAGAGCAAGAGTATCTTCCGAA
TTAGTTAAAGCAGCGAAATTCATGTCTGAATTCCTCAAGGATGAGCGCATTTCAAGATTA
TTATTGAGTTTATCTAATCATGGAGCTATTGATTTCAATATTACAGAGGCTAAAGCACCA
ACAGACACTGATAAAATTAAATTGAGTGATCTTGATTACTACAGCAGAAAATCATTCCCA
CCATGCATGAAATCATTAATGACTGCACTGAGAAACAAGCATCATTTGAAGCATTGGGGT
AGACTTTAATTAGGTCTTTTTATTAAAGGACTTGGGTTGACTATGGAAGAAGCATATACT
TTTTGGAAGCAAGAATTCTGCAAAACCATGGATTCCGACAAATTTGAGAAAGGGCATGGT
TACAACATCAGACATATGTTCGGTAAGGAGGGTAAGAAGGCTGACTACAAGCCCTGGAAC
TGCAACAAAGTCATCAACCAGACCACTCCAGGCCCCGAGGAGTACCACGGCTGCCCCTTC
AAGACTTACAGTGAAGAGCATTTGAGACAGCTGATTAGCTCCTACGGAGTGAAGCCAGAG
GAGATGAGGCCTATTATCGATAAGAGAAGAGAGAACTTGCATTAAGTTGCATGTTTGAGA
TTGTTCGAGGCCTCACATCCAAATGGTGTAGCTGATAATGTGGGAAATCACCCAAACGCA
TTCTTTAGCAGCAGTGTTTAATATCAAAATGACGTTGAGAAAAATAGATCAAGGAGGGAA
GCTCAGTAAGCTAATGCCACAGGCGCTGCTAGTCAAATCACAACGACAAGTGCTGAGGCA
AACACCTAACAGCAGCAAGTCAAACCTGACGTAGAAATGGCTTGA


>Contig15489.0.0.g18(protein)
MYDSNETQEKIKDTVFKMTKQHRIAIQVAAGSSSVYIPPENRREFKENDNISHFICRLAY
CRTEELRKWFLTQEVRLFQARMSEVKAETIQQLLELQCNIRYEQVKEDDQDWKQYGAKIS
FKFLKAEERRANCFVKVPFKEAISLVNRRQVFLLNGIAYVSIKDLTTILGAHFRARVSSE
LVKAAKFMSEFLKDERISRLLLSLSNHGAIDFNITEAKAPTDTDKIKLSDLDYYSRKSFP
PCMKSLMTALRNKHHLKHWGRLQLGLFIKGLGLTMEEAYTFWKQEFCKTMDSDKFEKGHG
YNIRHMFGKEGKKADYKPWNCNKVINQTTPGPEEYHGCPFKTYSEEHLRQLISSYGVKPE
EMRPIIDKRRENLHQVACLRLFEASHPNGVADNVGNHPNAFFSSSVQYQNDVEKNRSRRE
AQQANATGAASQITTTSAEANTQQQQVKPDVEMA