Identifiers and Description

Gene Model Identifier

Contig14240.0.g63

Standard Name

PRI1

Aliases

Contig14240_0_g63

Description

Eukaryotic and archaeal DNA primase small subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01896 ) Eukaryotic and archaeal DNA primase small subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005718802.9986068920536807e-84DNA primase, eukaryotic-type,
small subunit, ...
SGDYIR008C1.000296925633081e-74PRI1 SGDID:S000001447, Chr IX
from 374306-373077, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14240.0.g63(coding)
ATGGAGGTAGATTACCAAGCAAAATCAGAAGTTTAGACAAGTGGTGCATCAGGAATTGTT
GATATGGATTTCAATGTAGAATTATTGAAGATTTACTACGACAAGGCATTCCCATATAAT
GAGATGTTTAAGTGGTTGAGCTACAACAAATTCAAGAAGGAGAGCAGAATGTTGCAATCA
TTAGAAGATGATGTCGAATCCGACTATTTCCACAATCGTGAGTTCTCATTCACATTAGAA
AACGATGTCTACTGCAGATATTTATGCTTTAAAAATGCTCTGGATTTCAAAGAGACTTTA
GTATCTCGATGTCCACATAAGATTGATATAGGTGCAGTGTTCAATATTGCGCCAAAAAAC
CACAATTAAGCAGATAAGAAAGTTTTTATTCCTCTTGAAAAGGAGATGGTATTCGATATC
GATATGACTGACTATGATAATGTGAGAACATGCTGTACTGGAGCTAAGGTTTGTGTGAAG
TGCTGGGCTTACATGGCTTGTGCTACTCAAGTCATTAATCATGTACTTACAAAGGATTTT
GGATTTTCTTCACTTCTCTGGGTTTTCTCTGGTCGTAGAGGTATCCATTGCTGGATAGGA
GATGAGTAAGCCAGATAAATGACAAATGAGATGCGTTCTGCAGTCACAGAATATCTCTTT
TTGCCAACTGCAAACGAGATGAACAACCTAGATCTATCCTTCCCACTTCACCCTATGTTA
GAAAAGGCATTCAACTTCTTAAATAAGCACTTTGAACAGATAGTTATTAATGATCAGGAT
CTTCTTTCTCATGAAGCACATCAAAAGAAGTTCATCAAAATATTACCTTTAAATTTGCAA
GATTCTGTTAGATTTGAGTGGAATAAGGCACACACTGGAAGCGAGAAATGGGCTGCTTAC
AAAAAGATTGTTGATAAATATCAATCAGAAAAGAAGTAAGATCAAACAATGGTGAGACTA
GTATTTACATATCTATATCCAAGAATTGATGCTAATGTGTCCAAAGGCATTAACCATTTG
TTGAAGTCACCTTTCTGTGTCCATCCTAAAACAGGCAAAATTTGTGTTCCATTTGACCCA
AATCAAGTGTTCTAATTTGACATCCAAAATGTAGCAACTCTTGCTAAAGTGATTAACGAT
GTGGGAACCTCTAGAGACGGTAAAATTGAGTGTTTGGAGGAATCAATGGCAGTATTCAGA
AGTTTCTTGAGGAAACTTAAAACAGAGAATATCGAAGAAATTAGACAAATAAAAAAGGCA
AATGAAGAGAAAATTGAATTTTGA


>Contig14240.0.g63(protein)
MEVDYQAKSEVQTSGASGIVDMDFNVELLKIYYDKAFPYNEMFKWLSYNKFKKESRMLQS
LEDDVESDYFHNREFSFTLENDVYCRYLCFKNALDFKETLVSRCPHKIDIGAVFNIAPKN
HNQADKKVFIPLEKEMVFDIDMTDYDNVRTCCTGAKVCVKCWAYMACATQVINHVLTKDF
GFSSLLWVFSGRRGIHCWIGDEQARQMTNEMRSAVTEYLFLPTANEMNNLDLSFPLHPML
EKAFNFLNKHFEQIVINDQDLLSHEAHQKKFIKILPLNLQDSVRFEWNKAHTGSEKWAAY
KKIVDKYQSEKKQDQTMVRLVFTYLYPRIDANVSKGINHLLKSPFCVHPKTGKICVPFDP
NQVFQFDIQNVATLAKVINDVGTSRDGKIECLEESMAVFRSFLRKLKTENIEEIRQIKKA
NEEKIEF