Identifiers and Description

Gene Model Identifier

Contig5328.0.1.g75

Standard Name

PRFB1

Aliases

Contig5328_0_1_g75

Description

RF-1 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5328.0.1.g75(coding)
ATGATAGTGAAATGCCATGATTAACGAGAGCAAGCCACAAACAGAAGTATGGCGAGGAAG
ATACTTATGGATAAATTGGACATTTTAGTTAATGGGGAGTGCAGTAGACTTAAAGTCAAG
GAAATCAAACGAATTAGGACTAAAGATAGATATGAAAGACGCAGAAAATAGAATGGAGAC
AATGAGGAAGGAAAAATTGAAAAGGAATAGAATAGTGAAGATGAAGAATAAGATTCTGAT
TTAGAAATAGATGAAGAAAAGTACAGAGAAATGCTTAAAAATTCTAAAATAGGTGATACA
ATAAAATGA


>Contig5328.0.1.g75(protein)
MIVKCHDQREQATNRSMARKILMDKLDILVNGECSRLKVKEIKRIRTKDRYERRRKQNGD
NEEGKIEKEQNSEDEEQDSDLEIDEEKYREMLKNSKIGDTIK