Identifiers and Description

Gene Model Identifier

Contig14033.0.g36

Standard Name

PRDX1b

Aliases

Contig14033_0_g36

Description

AhpC/TSA family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007215308.995955939984105e-109AhpC/TSA family protein
SGDYML028W6.997420649987812e-71TSA1 SGDID:S000004490, Chr XII
I from 220138-220728, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14033.0.g36(coding)
ATGAAAACTGCATTCGCAATTTTATCACTATTCCTTGCAAGCGTTGCTTCTTTATCTATT
TTACCCAGATAGAATGCACCAAAGTTTTCTAACGTGAATGCTGTAGTTAACCAAGAATTT
AAGAAGGTGTCTATTGATGATTACAAGGGCAAATATTTGGTTTTGCTCTTTTATCCATTT
GATTTTACCTATGTATGCCCAACAGAATTGATTTCCTTCTCTGAGAACATCAGTAAATTC
CGTGAACTAGGCGCAGAAATATTGGGTATCTCAACTGACTCACACTTCACTCACTTAGCT
TGGATCAAGACACCCCGTAATGAAGGCGGTCTCGGCACCCTCGAATACCCCCTCATAGCA
GATATTTCCAAGGACATCTCCAGATCATATGGTGTTTTAGTTGAAGATAAAGATGATGAT
TTGTATGGTGCCGCTCTAAGAGGACTTTACGTTATTGATGGAAAGGGAAAGATCAGAAGC
ATGCAAATTAACGATGCACCAGTTGGTAGAAATGTAGAGGAGACACTCAGATTAATTCAG
GCTTTCCAACATACTGATACTCATGGAGAAGTCTGCCCTGCTAACTGGAAGCCAGGTCAA
AAGACCATCATCCCAGATCAAGAGCAAAAGAAGAAATATTTCTCATCTGAATTCGACAGC
TCATTATGA


>Contig14033.0.g36(protein)
MKTAFAILSLFLASVASLSILPRQNAPKFSNVNAVVNQEFKKVSIDDYKGKYLVLLFYPF
DFTYVCPTELISFSENISKFRELGAEILGISTDSHFTHLAWIKTPRNEGGLGTLEYPLIA
DISKDISRSYGVLVEDKDDDLYGAALRGLYVIDGKGKIRSMQINDAPVGRNVEETLRLIQ
AFQHTDTHGEVCPANWKPGQKTIIPDQEQKKKYFSSEFDSSL