Identifiers and Description

Gene Model Identifier

Contig18936.0.g109

Standard Name

PRDX1a

Aliases

Contig18936_0_g109

Description

AhpC/TSA family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002951703.9991157591502974e-89Thioredoxin-dependent peroxide
reductase, mit...
SGDYML028W8.998258374026963e-65TSA1 SGDID:S000004490, Chr XII
I from 220138-220728, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18936.0.g109(coding)
ATGCAATCTTTAAAGAAATTACTCCCAAGACCACTTTCCATGAGTGTAGGATAAACAAAG
GCTATTATCCCAGCCAGTTTAAGATACTTCTCAGAATCACAATGCCCAAACGCATGGATG
TATGCAGTCAAAGCTAGAGTTTAACACCCAGCTCCTAGATTTGAAGCAATGTCATGGCAC
ACTGATCAATTCAAGAAGATCTCTCTTGACGACTACAAAGGAAAGTATGTTGTACTCTTT
TTCTATCCTCTTGACTTCACCTTCGTATGCCCAACTGAAATCGTAGAGTTCAATGATAAG
GCTGATTAATTCAGAAAGAGCGGTTGTGAAGTCGTTGCTTGCTCAATTGACTCTCACTTC
GTTCATCAAGAATTCGCAAAGAAACCTAGAGACCAAGGTGGACTTGGAGGTATGAATATT
CCAATGTTGGCAGATTTGACCAAGCAAATCGGTCGTGACTATGGATGCCTAACTAAAGAC
GATGCCTTCCATCTCAGAGCAACTTACATCATTGATGATAAGGGAGTCTTGAGACACATG
CAAGTTAATGACACTCCAGTTGGAAGAAATGTAGATGAAGTTTTAAGACTAGTTCAAGCA
TTCTAACACAGTGACAAGCATGGCGAAGTTTGCCCCTCAAAATGGAAGCCAGGCACCGCT
GCAATGGACCCAAACCATAAATCTGACAAAACCTTAAAATACTGGAAATCAGAGCACACC
AAATGA


>Contig18936.0.g109(protein)
MQSLKKLLPRPLSMSVGQTKAIIPASLRYFSESQCPNAWMYAVKARVQHPAPRFEAMSWH
TDQFKKISLDDYKGKYVVLFFYPLDFTFVCPTEIVEFNDKADQFRKSGCEVVACSIDSHF
VHQEFAKKPRDQGGLGGMNIPMLADLTKQIGRDYGCLTKDDAFHLRATYIIDDKGVLRHM
QVNDTPVGRNVDEVLRLVQAFQHSDKHGEVCPSKWKPGTAAMDPNHKSDKTLKYWKSEHT
K