Identifiers and Description

Gene Model Identifier

Contig12239.0.g70

Standard Name

PPIL4

Aliases

Contig12239_0_g70

Description

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00160 ) Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007575502.0006398763136557e-76cyclophilin-RNA interacting pr
otein
SGDYHR057C0.0000000000499999055251093CPR2 SGDID:S000001099, Chr VII
I from 218843-218226, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12239.0.g70(coding)
ATGTACTTTCCAGATGAAATAAAAGCAAAATCCTCTTCATCAAGTGGAGTTCCTCAGAAA
TTTAATAGAAAAGGTCTTGTGGCTATGGCTAACAAAGGGCCGAACATGAATGGATCCGCT
TTCTTCATCACACTCTCTGATAATGAAATTCAGCATTTGAATAATAAGCATACTATATTT
GGTCAGGTGGTTGAAGGATTAGAGAATTTGGACAAGATCAATAATGCTTATAGCGACAAT
CAAGGTAGACCATACTAAAATATAAGAATAAAGCATACTATGATAATAGAAGACCCCTTT
GAAGATCAAGACCTACCAGGTCTAAAAGTGCCCTCAAGATCACCTTCACCCATTGTTGTT
AGAAAACAAAAAACCTCAAATGAATAGGGTGGAGATTTCTACGTTGATGAGGATTTAGAT
GAATGCTTGGAGGACGATGTTGATATCAATGCTTTGATGGAAGGAAAAACTGAAGATCAA
ATTTAACAGGAAATTAAGGAACATTAGACTAAGACTCGTGCTGCTGTTCTGGAAATCGTA
GAAGACTTGCCTGATGCTGATATTGAGCCACCCAAGAATGTTTTGTTTGTGTGTAAGCTC
AATCCTGTAACATAAGATGGAGACTTAAGACTTATCTTTTCAAGATTTGGTCCTATAAAA
TGCTGTGAGATTGTCAGAGATTGGAAGACAGGTGACTCTCTGTAGTATGCCTTCATCGAG
TTTGAGAATGAGGAATCTTGCATTGAAGCTTACTCAAGAATGGAAGGTGTGGCGATTGAT
GAACGTAGAATTCACATAGACTTCTCCCAATCAGTTGCCAAGGAATGGAACTAGTACAGA
AGAAAAATGCTTAAAACCGCAGCTGATTAGATTTTGGAGTAGGAGCAGGCCAGGAAGGAG
AAAGAGAGATAGGTCTATAACTTATTCTCAAACTACAAGAACAAAGATAGAGAAGGTAGA
AAAGATGAGTTAAGTGGAAGTAGATCAAGAGATCACAGGAGAAATGATAAAGATTATGAT
AGAAAGAAGGAAAATGATAGGGGTAAAGATCGGGATCGAAGAAGGAGTAGAGATAGAGAT
TATGATAAACACAGAGAAAGAGACAGAGCAGGTTATAAAGACAGAAAAAGATCTCGATCT
GATAGTAGAAATAAAAGAGATAAGAAAGATAAAAAGGATCATAAATCTTATTCTAGAGAT
GAAGAGAAGTACAGAGAAAGAAGACGTGATAGATCATGA


>Contig12239.0.g70(protein)
MYFPDEIKAKSSSSSGVPQKFNRKGLVAMANKGPNMNGSAFFITLSDNEIQHLNNKHTIF
GQVVEGLENLDKINNAYSDNQGRPYQNIRIKHTMIIEDPFEDQDLPGLKVPSRSPSPIVV
RKQKTSNEQGGDFYVDEDLDECLEDDVDINALMEGKTEDQIQQEIKEHQTKTRAAVLEIV
EDLPDADIEPPKNVLFVCKLNPVTQDGDLRLIFSRFGPIKCCEIVRDWKTGDSLQYAFIE
FENEESCIEAYSRMEGVAIDERRIHIDFSQSVAKEWNQYRRKMLKTAADQILEQEQARKE
KERQVYNLFSNYKNKDREGRKDELSGSRSRDHRRNDKDYDRKKENDRGKDRDRRRSRDRD
YDKHRERDRAGYKDRKRSRSDSRNKRDKKDKKDHKSYSRDEEKYRERRRDRS