Identifiers and Description

Gene Model Identifier

Contig22302.0.g105

Standard Name

PPIGd

Aliases

Contig22302_0_g105

Description

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00160 ) Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
  • ( pfam02455 ) Hexon-associated protein (IIIa)
  • ( pfam02724 ) CDC45-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR216C7.000846320060671e-65CPR6 SGDID:S000004206, Chr XII
from 573211-572096, Geno...
T. thermophilaTTHERM_005481304.99918933170902e-62peptidyl-prolyl cis-trans isom
erase, cyclophi...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22302.0.g105(coding)
ATGTAAATTTCCGAAGCAAGCACACCATCCAACCCAAGAGTCTTTTTCGAGATAGAAATA
GGTGGCAAACCTCAAGGCAAGATTGTTATGGAGCTTTTCAAAAACGTAACACCCCGTACA
GCAGAGAATTTCAGACAGCTTTGCACTGGAGAATCAGGCAAACGCAGCTCTAATGGAAAA
GTATTGAGCTTTAAGAATAGTGTTTTCCATAGAGTCATCAGGGAATTTATGATGTAAGGA
GGTGACTTCACAGCTTTTAATGGCACTGGTGGTGAGAGCATTTACGGTCGCACTTTCCCA
GATGAGAACTTCAAACTCAAGCACACTCAAAAGGGACTTTTGTCAATGGCTAATGCAGGA
AAGAATACTAATGGATCATAATTCTTCATTACTTACGCAGTAACTCCACATCTCAATGGC
AAACATTGCGTTTTTGGAAAGGTTGAAAGCGGCTACGATATCTGCCAAAAGATTGAGAGA
TTAAGATGCGATAGAAACGATAAGCCACAAGAGAAAGTTGTGATTGTAAACTGCGGTGAA
GTTAAGAAGCAAGTTGAGCAAAAGCCATAAGTCACTGAGAAAGCTGATGTCAAGCAAGCC
CAAAAGCATGGTAAAGAGGAAGAGAAACAGCAATCATCTCATCAAGAAAGAAAGGCAGTA
AACCCAGAAGACAAGGAGAAAGCACGCAAGGTTGAACGTAGTCGCAGCAGAGAGAAGAAT
GATACTACTGATAAAGTAAGACAGCATAATAAAGACAGTGAGGATTAGCAGAAGCATCAC
AGAAGAGAGAGTCAGCATGATAAAGATGAAGAAAGCAGTGAACACAAGTCAACATCAAGA
AAGCAAAGCTTGAAGTGA


>Contig22302.0.g105(protein)
MQISEASTPSNPRVFFEIEIGGKPQGKIVMELFKNVTPRTAENFRQLCTGESGKRSSNGK
VLSFKNSVFHRVIREFMMQGGDFTAFNGTGGESIYGRTFPDENFKLKHTQKGLLSMANAG
KNTNGSQFFITYAVTPHLNGKHCVFGKVESGYDICQKIERLRCDRNDKPQEKVVIVNCGE
VKKQVEQKPQVTEKADVKQAQKHGKEEEKQQSSHQERKAVNPEDKEKARKVERSRSREKN
DTTDKVRQHNKDSEDQQKHHRRESQHDKDEESSEHKSTSRKQSLK