Identifiers and Description

Gene Model Identifier

Contig20635.0.g113

Standard Name

PPIGa

Aliases

Contig20635_0_g113

Description

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00160 ) Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001187101.99927841627239e-68peptidyl-prolyl cis-trans isom
erase, cyclophi...
SGDYDR155C3.0000115468388957e-66CPR1 SGDID:S000002562, Chr IV
from 769000-768512, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20635.0.g113(coding)
ATGTCACTTCACTCAAAAGTATTCTTCGATATCGACATCGGTGGATCAAACGCAGGTAGA
CTCGTATTCGGTTTGTACGCAGACACCCCAAAAACCTCTGAAAACTTCAGAGCTCTCTGC
ACTGGTGAGAAGGGCATTGGCAAATCAGGCAAGCCACTCCACTACAAGGGATCCAAGTTC
CATAGAGTCATTTCAAACTTCATGGCACAAGGTGGTGATTTCACTGCTGGCAACGGTACT
GGTGGAGAGTCCATCTATGGTGCTAAATTCGCTGACGAGAACTTCATTCACAAGCACACC
CATGCTGGTCAACTTTCAATGGCCAACGCAGGTCCAGGCACCAACGGATCTCAATTCTTC
ATCACCTTCGATGCTTTCCCACATCTCGATAACAAGCACGTCGTCTTCGGTGAACTTGTG
GAAGGTATGGAAACCCTCCAAGCCGTCCACGCCGTATCCTCATCAAGTGGTGCTACCAAG
AAGGCTGTTACAATCACCGAATCAGGTCAACTCGAATGA


>Contig20635.0.g113(protein)
MSLHSKVFFDIDIGGSNAGRLVFGLYADTPKTSENFRALCTGEKGIGKSGKPLHYKGSKF
HRVISNFMAQGGDFTAGNGTGGESIYGAKFADENFIHKHTHAGQLSMANAGPGTNGSQFF
ITFDAFPHLDNKHVVFGELVEGMETLQAVHAVSSSSGATKKAVTITESGQLE