Identifiers and Description

Gene Model Identifier

Contig19376.0.g82

Standard Name

PPCS

Aliases

Contig19376_0_g82

Description

DNA / pantothenate metabolism flavoprotein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04127 ) DNA / pantothenate metabolism flavoprotein
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam05401 ) Nodulation protein S (NodS)
  • ( pfam02353 ) Mycolic acid cyclopropane synthetase
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam00398 ) Ribosomal RNA adenine dimethylase
  • ( pfam05891 ) AdoMet dependent proline di-methyltransferase
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam05219 ) DREV methyltransferase
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam03686 ) Uncharacterised protein family (UPF0146)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIL083C2.0005131442217614e-40CAB2 SGDID:S000001345, Chr IX
from 204653-203556, Genom...
T. thermophilaTTHERM_013090900.00000000000001000191320216021DNA / pantothenate metabolism
flavoprotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19376.0.g82(coding)
ATGGAGTCACTGTAAACTCACTAACAAAAGCTACCATCCACTGCAGCACAAGAGTTAGCC
CGCATGCTGAACAAGTCAATCGCGAACACAGCACCTGACAACATCGAACTCAACACAACT
CTGTGGGATAATTACGCAAGAGAGTGGTCCACTGAGAAAGATTGGGTTAAAAACATGATC
AAAGATAATCAGCAAGAAGCGAGAACTCAAGAACTAGTTCTTGGCGAAGAATGGAGTGAT
CTTTAATCTTTCCAGCAAGTGTTTGATGAATATATCATACCAAATCTATCAAATGATAAG
AAAGTGCTTGAAATCGGAGTGGGAGGAGGCAGAGTCGCCAGATTATCAGCAGAACTTTGT
AAGGAACTTCATTGTGTTGATATCTCATCTGAAATGATCAAGAAAGCTAAGTAAAACACT
AATATGCATTAGAATATTCATTTCTATCACAATGAAGTCTCTCCTAAGTTTCCTTAGGAA
GTAATAAATCAGGGTCCCTTCGATTTCATCTATTCCTTTGATGTATTTGTACATGTTGAT
ATTCACACTTTAAGAGACACTTTGCTTAACTTAAAATAACTAATGAGAGAGGATACTCTA
TTCTTCATAAGTGTAGCAAATCTTTGCAGTGAGAAAGGCTATGAAAGATTTAAGAAGTAG
TCTAAATTCAAAGTAGCAGGATTTTATTTTATGAGTCCAGATATCATTAGAAAAATAGTT
CATGAAACAGGTTTTTAGGTTGTTAGATGTTAATTGGATGAAAATCATTTCGATTCTAAG
AACTTATATTACCATCGTGACATTTTGCTAACACTGAAGCTTAAATCAGAGCATGATTAA
TTAAAAGCAGTTTAACCTTCTCAATCCATCCCAATATTTGATAAGATTTCTCACTTCTTA
TAATAAACTCAAATTTCAAAACGGCCTCTAGCTTTTGTAACCTCAGGTGGAACCAGTATA
CCATTAGAGAAGAACACTGTGAGATCTATCGAGAACTTTAGTACAGGTCAGAGAGGTGCC
AGATCAACCGAGTATTTCTTGAAATAGGGCTATCGTGTCATATTTTTATACAGAGATAAA
AGTATCAAGCCATTTAAGAGTAGAGTATCGATAGATCAACTATATGACGATGGCTTAGAG
TTCGGTGAGATTGCCAATAAGAAACTTGTTGAAAGCATAAAAGAGTTCAAGAGATACTAA
GGTGACTTATTGATGATACCATTCGTCACTCTAATCGAATACCTAGATTGGTTAGAGTAT
ATTTCAATTGCTTTTTCAGATCATTAAATTGAGTCACTTACATATCTAGCAGCTGCGGTC
TCTGATTTCTACATCCCTCCTGAATAGATGGCTGAACATAAAATTTAATCCCGAGACCAC
GATGGTTTAGATTTGCATCTCTAACCGACACCTAAATTGCTAGGCGCTATAAAATCTTAA
TGGTCTTGTCATCCAAATTAGACTTTCTTGATTTCATTCAAACTAGAGACTGATCTATCC
ATACTAGAGAAGAAAGCTATGGGAGCGATTTAAAACTATGGAGTGGATGCTGTCATTGCA
AATGAATTGCACTCAAACAAGTATAAAGTCATTATTTATCATAGTCCTAATACCACCAAA
TTACTTGAGAATAGTGTTGATATGCTAAACGATTGTGCTAATGATATTGGGAAGAGTAAA
ATCATTGAAGTTAATTAGGAGAAAGTAGTGAGTGGAGAAGTTGAAATCGAACAATTTATC
ATTGATCATGTTAACAAGCTATTTAAGGCATATTTGAAGCAAAAAGAACAAACCAATCAT
TAATAATGA


>Contig19376.0.g82(protein)
MESLQTHQQKLPSTAAQELARMLNKSIANTAPDNIELNTTLWDNYAREWSTEKDWVKNMI
KDNQQEARTQELVLGEEWSDLQSFQQVFDEYIIPNLSNDKKVLEIGVGGGRVARLSAELC
KELHCVDISSEMIKKAKQNTNMHQNIHFYHNEVSPKFPQEVINQGPFDFIYSFDVFVHVD
IHTLRDTLLNLKQLMREDTLFFISVANLCSEKGYERFKKQSKFKVAGFYFMSPDIIRKIV
HETGFQVVRCQLDENHFDSKNLYYHRDILLTLKLKSEHDQLKAVQPSQSIPIFDKISHFL
QQTQISKRPLAFVTSGGTSIPLEKNTVRSIENFSTGQRGARSTEYFLKQGYRVIFLYRDK
SIKPFKSRVSIDQLYDDGLEFGEIANKKLVESIKEFKRYQGDLLMIPFVTLIEYLDWLEY
ISIAFSDHQIESLTYLAAAVSDFYIPPEQMAEHKIQSRDHDGLDLHLQPTPKLLGAIKSQ
WSCHPNQTFLISFKLETDLSILEKKAMGAIQNYGVDAVIANELHSNKYKVIIYHSPNTTK
LLENSVDMLNDCANDIGKSKIIEVNQEKVVSGEVEIEQFIIDHVNKLFKAYLKQKEQTNH
QQ