Identifiers and Description

Gene Model Identifier

Contig678.0.g97

Standard Name

PPC1

Aliases

Contig678_0_g97

Description

Phage protein C

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig678.0.g97(coding)
ATGAATGGTTAGACATTAAAAAGATTTCCGGTTTTCACTAATTAAATGCTCCCTTTAGTC
AGTTTACACCCTTTATTAATCAAAATCGCTGCTTAAACTCTAAAATTAGTAATTGAAAAC
TGTGGAGAATTTAGGCTATGTGAGTAAAATGAAACTGTATACTTTGAAGATGCTAATGAC
ATGTAGATATTTATACCTATTTTTGGTTCCCTAAGGATTTGGTCAAGATAAAATGGGATT
TTAGGGAGGATAAATGTTGGGCAACCAGCTGGTGAAGAGTGCTTTTGCGATTCCAAGTAC
ATAAATAGAATAGATTCATGTGTAACAAATGAAGTTGGCTAATGTGGGCTGCTAATTATT
GATAGAGAACTTTATCATGATATAAAAACTGAAAATACAAAGGATCACTTCAAAGACTTA
AACATGCTTGATTCGATATTTAGGAGAAATTTCTTTATTAAAAAGCATTGGAGGAATGAG
GGAGGTATTAAAAATGTTAAATTTGGTAAGATTTAATAAGAATATACTTAGTAAAGATAT
AAGGAACCTGGTCCTTTTTAATTTTGA


>Contig678.0.g97(protein)
MNGQTLKRFPVFTNQMLPLVSLHPLLIKIAAQTLKLVIENCGEFRLCEQNETVYFEDAND
MQIFIPIFGSLRIWSRQNGILGRINVGQPAGEECFCDSKYINRIDSCVTNEVGQCGLLII
DRELYHDIKTENTKDHFKDLNMLDSIFRRNFFIKKHWRNEGGIKNVKFGKIQQEYTQQRY
KEPGPFQF