Identifiers and Description

Gene Model Identifier

Contig8934.0.g106

Standard Name

PPAN

Aliases

Contig8934_0_g106

Description

Brix domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR312W9.996907204735647e-62SSF2 SGDID:S000002720, Chr IV
from 1087581-1088942, Gen...
T. thermophilaTTHERM_007653003.000458792073453e-56ribosomal protein S11 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8934.0.g106(coding)
ATGCCCAGAAAAGGAGGAAAGAGAAAGAAGACCAGAACTCATAAAGAAATAGTTGATGAA
GATGTAGAATTTGCTCCCAAATCATTCATTATCAAGAGAGGAAAGATAGGTATTTACTTG
AAAGAGTTGCTGATGGACATGCGTGAGCTTATGTACCCCTACACTGCTCTTAAATTAAAA
GACAAGCAAAAGAATACTCTCAAGGATTTCATGTCAGTAGCTGGTTAATTTGGAGTAACT
CACATGATGATGTTCTCACAGACAGATAAATCCTGCTACATAAGATTTATGAAGAACCCC
AAAGGGCCCACAATCACATTCAAGATTGATGAGTATTCACTATCAAGGGATGTTATTAAG
TACCAACAAAGGAAGAGAACAAGCAAAGTTTTCTCAAGAACCCTTCAAAATGCTCCATTA
TTGATTATGAACGGTTTCGGTAATAGAGATGAGAATGATGCATACAAAATTGTGTCACTT
ATGGTTTAGAGCATGTTCCCACCCATTAAAGTTCAAAGCATGAACTTATCATAATGCAAG
AGAGTCGTTTTATTCAATCTTTTAACTGATGAGAATGGTGAGGAATTTTTGGAGTTCAGA
CACTATGGATTATCTGCTCGCCAGAGATCTATTAACAAGTCAATCAAACGTTTAGTTAAT
AACAAGAAAGTTCCTAACCTGTCTCGTTACAATGATATTTCAGATTATATCTACTCTAAG
GGTGGTGGCTATTCCTCAGAATCTGAGGTTGATGATATTCCAGAATCCAAGATTATCTTG
CCTGAAGACTTCCAAGATAAAAAGAAGAATACTAATGTTGCTATTAAGCTTCACGAAATT
GGACCTAGACTCAGATTGAGATTGGTGAAGATTGAAGAGGGCGTCTGCCGTGGTAACGTT
GTCTATCACGCATACGTGAAAAAGACCAAGGGAGAAATTAAGGAACAGTTTGATGACATC
AAGAAGAAGAGAGACCTCAAGACTGAAAGAAAAAGAGTCCAAGATGAAAATGTCAAAAGA
AAGCAGGATGTAAAAGATGCTAAGGATGCTATTAAGAAAAGTAAATATGCGAATAAAGAG
GAAGATGAAGATGAAGAAGATACTGGAAAGAAGAGAGATAAGAAAACAACTGGAAATAAG
TCAGTTGGTTTTAAAGAAGAAGAGTACAATGATGCCTAATTTGATGAAACAAAGGATGCT
AGAGCTTTGCCTAAAAACATTAAATACATGAAAAACATGCCAAACAAACCAATCCTTGGA
AAAAGAAAACAAAATTTCACAACTTTAAACTCTAATAATCAAAATAAACCAAAAGGAATT
GAGGAAGATCTCCTAGGCTTGGGATATACAAGCAGTAGCAGCAACTCGAACATTATTAAA
TAGAATAAAAATAGCAATTTACAAAATAGGAAGAAAGTCAATGGTGGAGGTAGCGGTGCA
TTATTTAATCCTGATGACATCTTAACTTCATTTGCCAGTGGAAGCAGAAGGACAAATGAT
TTTGATGATGATAATGATGAAATCATAAAGGAGAGTACAAGCTTGCTGAGCTCTCAAAAC
GAAGATTTTAAGCCAATTTCTAGTAAAAGTACAATAAATATGAGCGCTTATCCAGGAGGA
ATAAATCCGATTTAAGCGAAATAAGCTATGCAAGAAAAAATGAAGAAGCAAGCTAGTATG
TCTAATGAGAGACCAAAGAATCTGGTATAAAAATTCATATTTGATCCTTTCAAATATCAA
GCATACTTCGACACAACAACAGATGAAATATAAAATAGAATGCTGGATGCTTTGTGGCCA
TTTATTCCTGAGAATTAGCATCATCTGATTGAGAATGATGCTGAGTAAGTTAGGGAATTC
TAAAAGAAACCAAATCAAAGTAAAGAGTTATATGGGCCAATCTGGATCATGGTTACTCTG
ATTATAGAATTATGCATTTTAGGTCATCTGCAGACTGTTCTATCAAGTCAAAGTCATTAC
TCTAGTTCTCTAACTGCAGAAGATATTCTAGTCAAACAAGCTAACTACAGCATATAAAAG
GTGTTTAAAACAACATTCTTCATACTGCTTATGTTTATAGTAAATCCATTCGTGAGTTAC
TTGATTTTCAAGAACAGAGGAGCAATTGAAGTTACCTATGCCAGTTTATTTTAGATTTAC
GGCTATTCCTTCGCTATTTTTATACCACTTGCACTAGTGAACTGCATATTCATGCCACTT
AACAGACTCAGGATATTTCTGCTGCTAGTTTGTGGAGCGATAAGTTTGTACTATTTATAC
AAAGAAACCAAGGAGTACTTAACTAAATACATAGTGGATGATCAAACATGGAAATACTTC
GTTGGCTACATTACTGGGTCTACTGCTTTCTTTATTTCTTAAATTAATTAAAAGGAAGGT
ATTATTATTCAATATATCTCAGAAGCAGATAAATGGTAACTATTATCACGAACCGCTCAT
CTTTTGTTTTTATAGTCAAAGGCTCAAAAGAAAGGAAAGGCAGCAGTAGAAGGCGCAGAT
GGTGAAGAAGGTGCCAAAGAAGAGAAGATTACCTACTACGGACCCCCAGTTGTTGGTGCA
GGTAAACAGACCGAAAACGTTTTTGGCGTCTGCCACATCTTGGCAACATTCAACAACACC
TTCATCCATGTTACTGATCTTTCAGGCAGAGAAACCTACGCAAGAATCACCGGTGGTATG
AAAGTCAAGGCTGACAGAGAGGAGTCATCCCCTTATGCCGGTAAGTGTCCCACACAGCAT
TAGCTATCAATGTGCTTGACTCATGAGCTTGTGCATTTGCTTAGCTGCTCGTTTGCCTCC
AACAATCCCGAATCTTTTTCTCTATTTAAGTACCAATTGATATTAACTATGCTTGCTGCC
GTCGACGTAGTCAAGGCCCTTAAGCAAGTTGGTATTAACGCTGTCCACATCAAGATGAGA
GCAAGAGGAGGTGTTGAGACCAAGACCCCAGGCCCAGGAGCTCAATCAGCTCTTAGAGCC
CTCGCTAGAAATGGACTTAAAATTGGCAGAATTGAGGATGTCACTCCTGTTCCAACCGAT
ACAACCAGAAGAGACGGTGGTCGCAGAGGTAGAAGACTCTGA


>Contig8934.0.g106(protein)
MPRKGGKRKKTRTHKEIVDEDVEFAPKSFIIKRGKIGIYLKELLMDMRELMYPYTALKLK
DKQKNTLKDFMSVAGQFGVTHMMMFSQTDKSCYIRFMKNPKGPTITFKIDEYSLSRDVIK
YQQRKRTSKVFSRTLQNAPLLIMNGFGNRDENDAYKIVSLMVQSMFPPIKVQSMNLSQCK
RVVLFNLLTDENGEEFLEFRHYGLSARQRSINKSIKRLVNNKKVPNLSRYNDISDYIYSK
GGGYSSESEVDDIPESKIILPEDFQDKKKNTNVAIKLHEIGPRLRLRLVKIEEGVCRGNV
VYHAYVKKTKGEIKEQFDDIKKKRDLKTERKRVQDENVKRKQDVKDAKDAIKKSKYANKE
EDEDEEDTGKKRDKKTTGNKSVGFKEEEYNDAQFDETKDARALPKNIKYMKNMPNKPILG
KRKQNFTTLNSNNQNKPKGIEEDLLGLGYTSSSSNSNIIKQNKNSNLQNRKKVNGGGSGA
LFNPDDILTSFASGSRRTNDFDDDNDEIIKESTSLLSSQNEDFKPISSKSTINMSAYPGG
INPIQAKQAMQEKMKKQASMSNERPKNLVQKFIFDPFKYQAYFDTTTDEIQNRMLDALWP
FIPENQHHLIENDAEQVREFQKKPNQSKELYGPIWIMVTLIIELCILGHLQTVLSSQSHY
SSSLTAEDILVKQANYSIQKVFKTTFFILLMFIVNPFVSYLIFKNRGAIEVTYASLFQIY
GYSFAIFIPLALVNCIFMPLNRLRIFLLLVCGAISLYYLYKETKEYLTKYIVDDQTWKYF
VGYITGSTAFFISQINQKEGIIIQYISEADKWQLLSRTAHLLFLQSKAQKKGKAAVEGAD
GEEGAKEEKITYYGPPVVGAGKQTENVFGVCHILATFNNTFIHVTDLSGRETYARITGGM
KVKADREESSPYAGKCPTQHQLSMCLTHELVHLLSCSFASNNPESFSLFKYQLILTMLAA
VDVVKALKQVGINAVHIKMRARGGVETKTPGPGAQSALRALARNGLKIGRIEDVTPVPTD
TTRRDGGRRGRRL