Identifiers and Description

Gene Model Identifier

Contig16499.0.g122

Standard Name

POP5

Aliases

Contig16499_0_g122

Description

Rpp14/Pop5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAL033W0.0000000029989608248573072POP5 SGDID:S000000031, Chr I f
rom 82706-83227, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16499.0.g122(coding)
ATGGTGAGAGTGAAACAGAGATATATTTTGGGAGAGATTCAATTTAATGAGGCTGGTTTA
ATTGATATACAAACTTTTAACTAGAAAACATTAATTGAAGCATTCAGGGTAGCGGTATAG
GATGCCTATGGAGATCTTGGACTTGCCAAAATTTAGTCTAATTTCATTGTTAAATATTGG
AATCCTGCGACTAAGGTATTTATATTAAAAGTGGGGAGAGAAAACGAAGACGTAGCAGTA
AGCAGCTTAATTATGATAACTAAGCTGTACTAATATGAATGCAAAATCAGGACTCTTCAC
ATAGCAGGTACACTTGAGAAAGTAGAATAAGCTTTGAAGAAAATGACTGAATCATGGATT
GAATCATAAAGTAAAAAGAATTAACTGATTCAGCAATCAATATGA


>Contig16499.0.g122(protein)
MVRVKQRYILGEIQFNEAGLIDIQTFNQKTLIEAFRVAVQDAYGDLGLAKIQSNFIVKYW
NPATKVFILKVGRENEDVAVSSLIMITKLYQYECKIRTLHIAGTLEKVEQALKKMTESWI
ESQSKKNQLIQQSI