Identifiers and Description

Gene Model Identifier

Contig868.0.g7

Standard Name

POP4

Aliases

Contig868_0_g7

Description

Domain of unknown function UPF0086

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01868 ) Domain of unknown function UPF0086
  • ( pfam09606 ) ARC105 or Med15 subunit of Mediator complex non-fungal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010053302.9992476920535046e-16hypothetical protein
SGDYBR257W0.00000000002000577768187062POP4 SGDID:S000000461, Chr II
from 728885-729724, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig868.0.g7(coding)
ATGTCAAAGAAACCAGGAGGTCAGAAGAAAGAGGATATATTAGCATTTTTGGATTCTAAA
TTTTCCAAGTTTGATAGTAAAAAACAAGAAAAAGATAAAAAGAAAAGAGATGAAAAGTTT
CAATCTAAGCCCAAGAATGTTTAAGAAATAAACTCAGTGATTACTAATAATCAGCAGCAA
GAAATCAAAACAACAGTAAATAAGTTCAATTAAAAGAATATAAAGAATCAATAAAATAAC
ATAAAAACTAATCAATAATCCTAGAAAGAAATGCTTGATTACAGTATAAGTAATGAATAA
TAAGTTGACATTCTTAATATTAAAGATCAATCTTTAGCCTAATCTACTTCTCTTCAAACT
CAAAATACTTAAATGCTTTTAGCAAGTACATAATCCCAAAGTTAATTGTCAATTCAAAAC
TAAAATCAACTTTAATAAGCGCTTCACCAAACTTAGCAACATAACCCCTTATTAAGAGAC
GATGTTTTGTACAAACCACTAAATTAAAGTTAATCACAAGCTTAAATAAACAAGGATCTC
TAGCAATTCAAAGATTTCTCACTTAAGAATCCTAAGAATTACGATTAAGACCTGAAGACC
AAGATATTCTTTATTGGATAGAACAATCTAGGCAGTATTTAGAGTGAAAATACAGGTGGT
GCTGGAATGGGGTCAGATTAGCAAAGTTTGAAGTAAAAGTAGCAGCAAAGACAATAAATG
GTTCAAGCGTAGAGACATGTTTCCAAGAACACTCTAAAGTAATTAGATAAACTACAGTAA
GTTTAATAGGCAGAGTTGAAGTATGACACTTTTGTCAATCTAAACAAACTATGGTGTTAA
TACATAATGACTCTACTTGGTAGAGATGAAAACATGGCTTCTGTTTGTGCAAAAATAGTA
AAAGCAGATCTTAACGGTGCTTGTCTAACAGTAGTAAAAAGCAAAAATCCATGCATGATA
GGTGTGAGTGGAATTGTAGTAAGGGAGTCAGTAAGATGCTTGTTTATCATTAATGAGAAA
AATGAAGTCAAGAATCTATTGAAATCTGGATCAGTGTTTGAAATCGACTTAAAAGACGGA
GAAAGATTTGTTAGAATATGGGGAGATAACATTCTGTTTATGGGCAGTGAGAGAACTAAA
GTTAAGTTCAAGGAAAAGTTTGCTCTTGAATTGTATTGA


>Contig868.0.g7(protein)
MSKKPGGQKKEDILAFLDSKFSKFDSKKQEKDKKKRDEKFQSKPKNVQEINSVITNNQQQ
EIKTTVNKFNQKNIKNQQNNIKTNQQSQKEMLDYSISNEQQVDILNIKDQSLAQSTSLQT
QNTQMLLASTQSQSQLSIQNQNQLQQALHQTQQHNPLLRDDVLYKPLNQSQSQAQINKDL
QQFKDFSLKNPKNYDQDLKTKIFFIGQNNLGSIQSENTGGAGMGSDQQSLKQKQQQRQQM
VQAQRHVSKNTLKQLDKLQQVQQAELKYDTFVNLNKLWCQYIMTLLGRDENMASVCAKIV
KADLNGACLTVVKSKNPCMIGVSGIVVRESVRCLFIINEKNEVKNLLKSGSVFEIDLKDG
ERFVRIWGDNILFMGSERTKVKFKEKFALELY