Identifiers and Description

Gene Model Identifier

Contig4067.0.g99

Standard Name

POP1

Aliases

Contig4067_0_g99

Description

Ribonucleases P/MRP protein subunit POP1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam06978 ) Ribonucleases P/MRP protein subunit POP1
  • ( pfam08170 ) POPLD (NUC188) domain
  • ( pfam08669 ) Glycine cleavage T-protein C-terminal barrel domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002222802.0003218023735366e-33Ribonucleases P/MRP protein su
bunit POP1 cont...
SGDYNL221C0.000000009000371344152433POP1 SGDID:S000005165, Chr XIV
from 233695-231068, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4067.0.g99(coding)
ATGAGAGATAAGCGTAAAGACTAATATCAAATTGCCAATGATCCTTTCTTAAATTCTCTG
AAATCTGGTTCAGGGGATAAAGGTGTGCCTTAATATATAAACATTCACAAATTCCTGGAG
TCAAGGGCTCATGAATTGAAACATTTCTCAAGGATTTTATCTAATAAATTTACTTCTAAA
CTTGAACATCAATTGTTGCCCAAGCACATGCGAAGAAGAGCTATGGCCCATAACTACTAT
AGAATTCCATTAAGAATCAGGTTCAAATCTCTTTTGGAAATGCAACCTTCTGAGGGAGAT
ATTTTAAGCAGAAGCAGATGCAGAAGGCATAGGAGAAAGATAAAGTACTTGCTTAATTAA
TATGCAATGAGGCAAAGAGAACATAAATGGACTGAGAGTCATATTTGGCATGCCAAGAGG
TTTTAGATGAAAGAGAAATGGGGATACAAAATTGCTTATAAATCCACTGATAAAAGTGGA
AGGACTGTGTACAGATTATGTCAAAGAAATAGTGCTTGTATTTATGATTAGTCTTTTATG
AGAACTTCATTAGTTGAAGGCAACGAGGCTGTTTAAATGATATCGAAATAATTTAACCTT
AAATTCAATACAACAGTTGTTTAAGATAGAGATATTCTAGATTAGCAAGGAAAATTGATT
TGCCCTATAAGTATGCTAATTCTTTCTCCTTAGAAACTTTTAGTAATTTATCATCCTTCA
AGTTAACAAAATATTGATGAAAGCTTTGCAAAATCTTCGATTATCCTCAAGAATTAAAAT
CTAAACAACTTTTCAATCCTTAGCCAAAATATATCTCTCATGCAACTCTACAATGTTCTC
TAACCATTAGCTTTTGATAAAGAGTCTGAAGATTCCTTAACTCTACTCTCAGACCTCTAA
TTTGATCAGACAAAAATAAATGATAATCAGGTCCTATATTTAAACTTAGACAGGGAAATG
ATAAATCAAAGTTTCAAGATGAATGAGAGAACTTTCAATTTTGAGATGTCTGCAGTTTGC
AAAGATAATCAAATCAACTTTCAAGGCAGAGATCTGTTTTATGATCATACTTAGAAGAAA
AATGTTCCTAAAGAAGTCAAAAAGAGTGACTAAATGTAAATAGATACAAATAACTAATAG
TAAAACTAATAGCCTTAATAATAGCAGAAAAGAATAAATGTTAGGGAAGCAAAAAATGCT
ATATCTTAATCTAATTTCGTGCATAAATCATTTATAAAGACAAAAAGCGTCCATAGCGTT
GCCGAATAGAATGACTACTATGAATAATTTATTGTATAGCAATAAAACCTAGAAAAGCTT
AAATCTCTCTAAGAGCAAATTTCTTAGCAAGTAAACCTACAAGGAATCAAATAAAAGCCT
ATATAATTTATTGGAAGTCAAAGAACCCCTTTTACTCATAGAAAGAATAAATAGAGAAAT
AAAATCAAGGATTTAATTACAAGATTGAAGCAAGCCAAAGAAATTCATGATAAATAAAGA
GTGGAAAGAAAAGAGAAATTAATGAATGAACATTAAGATAAAGTAAAATAATAATTAGAG
AAAGACTCTATTTAAAACCAAGATGTTCAAATGAAAGATTCTACTGAAGCTGATGAAAAA
GAATATATCACAGTAATTGTATTCAAGAATAAGTTCCACCATCAAAACAACTTTGGTGCT
TCATTTACAATCCTGATCCCAGAGGGCTACGGATTAAACATGCTAAGAAGGTTCGTATAT
TCTGGTTGTAAACCTATAGGTTACAAAGAATTTCTAGCAATTAATCTCGAAATAGGAAAT
CCAATATTTCCTCAAGACTTCTATCACACGTAAGCAGGCAAAGAACAAGGAGCTATTACC
CTGCATGAATAAACTGAGATTTACTGTAAGAGACCTTCATCTAAACGCATAAATTATCAA
TGTTTGAATTTTTCAAGCCCATTTATGCCAAAAATAGAGGAGGATTAAAAGTACAAATTT
ATTAAGCTATTCAGTTTGATGAGAGGAGTCGCATAGGATGGGGCTATGGTATGCCTCCCA
AATGAATAAGACTTAAGTTAGATATCATAGATTTTACAAAACTATAAGAAAAGTTACCAG
GCATTTGAATTACTAGAGAATTCAAACTAAACCAGTGCTAAAAACAAATTCTTAAACTTC
GAGTATTGTTTGATGGCTGGAAAGAATATAAACTTATCCAAATCTGATTAGAATAAAATT
GAGAAAATAAGGTCTGGATAGCTTCTTTACGAGATGAAGATCTTAGATAATGATGGTTCG
TTTAGATTTTAATGCTTGAATGATGACGAGCTAAAAAGACAACCAATAGGATATGTAACT
AGAGGAGGCTATTCACAATTAAGAGGGAAGAGTATCGGAATAGGGTTAGTGTAAGTTCAA
AAACTGCAAGAGTTTAAGTAAGATTATGAGAGATTAAACTAGAGCTCTAAATTCTTAAAA
GGATATATTTTATTGATAAGAAACCCAAACTCATTAAGATACATTCCGTTCGTTTGCTAT
GATAAGTAGTGA


>Contig4067.0.g99(protein)
MRDKRKDQYQIANDPFLNSLKSGSGDKGVPQYINIHKFLESRAHELKHFSRILSNKFTSK
LEHQLLPKHMRRRAMAHNYYRIPLRIRFKSLLEMQPSEGDILSRSRCRRHRRKIKYLLNQ
YAMRQREHKWTESHIWHAKRFQMKEKWGYKIAYKSTDKSGRTVYRLCQRNSACIYDQSFM
RTSLVEGNEAVQMISKQFNLKFNTTVVQDRDILDQQGKLICPISMLILSPQKLLVIYHPS
SQQNIDESFAKSSIILKNQNLNNFSILSQNISLMQLYNVLQPLAFDKESEDSLTLLSDLQ
FDQTKINDNQVLYLNLDREMINQSFKMNERTFNFEMSAVCKDNQINFQGRDLFYDHTQKK
NVPKEVKKSDQMQIDTNNQQQNQQPQQQQKRINVREAKNAISQSNFVHKSFIKTKSVHSV
AEQNDYYEQFIVQQQNLEKLKSLQEQISQQVNLQGIKQKPIQFIGSQRTPFTHRKNKQRN
KIKDLITRLKQAKEIHDKQRVERKEKLMNEHQDKVKQQLEKDSIQNQDVQMKDSTEADEK
EYITVIVFKNKFHHQNNFGASFTILIPEGYGLNMLRRFVYSGCKPIGYKEFLAINLEIGN
PIFPQDFYHTQAGKEQGAITLHEQTEIYCKRPSSKRINYQCLNFSSPFMPKIEEDQKYKF
IKLFSLMRGVAQDGAMVCLPNEQDLSQISQILQNYKKSYQAFELLENSNQTSAKNKFLNF
EYCLMAGKNINLSKSDQNKIEKIRSGQLLYEMKILDNDGSFRFQCLNDDELKRQPIGYVT
RGGYSQLRGKSIGIGLVQVQKLQEFKQDYERLNQSSKFLKGYILLIRNPNSLRYIPFVCY
DKQ