Identifiers and Description

Gene Model Identifier

Contig18352.0.g53

Standard Name

POLR3H

Aliases

Contig18352_0_g53

Description

RNA polymerase III subunit Rpc25

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL144C1.999598840915195e-17RPC25 SGDID:S000001627, Chr XI
from 176481-175843, Geno...
T. thermophilaTTHERM_005792800.00010003404299092957RNA polymerase Rpb7, N-termina
l domain contai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18352.0.g53(coding)
ATGTTTGAGCTGTACACAATAGTAGACGAAGTAATTTTGTAGCCAGGGGAATTATCAGAT
TTCAATCTCACTCTAGAGAATAAAATCAAAGCCAGACTTTTAAATAAGGTATTAGCAAAT
GAGGGAATATGCGTGGCAATAAAATCAATAAAAGTACTTGAAAAAATTATCGTAGTAGGC
GAGGGGTCTGTGCAATGTAAAGTAGAAACTAATCTTGTGATATTCAGGCCTATTGTCAGT
GAAATTTTAAATGCAAAAATCACTCTTCAAAATGAATATGGAATATTTGGGGTGGTAGGA
TGTGCTCCTGTTTTTATTCCTTCAGAAAATCTCATTAAACCATCTTTTTATGACACCTTG
GAAAAGAAATGGCTCTGGAGATATTACGATGAGTCTTTGAAACAAGACCACGATATGTAT
TTCCAAGATGGGCAGACAATCCGCTTTCGAGTGAAGGAATTGAATTTCACTAAAGACTAC
CAAAATAGAATAAAACAGCAACAAAACTACGCTCTGCAGATGAATTAAGAACAAAATTAA
CAAGCAATTGGTGACACTGATTAAAATGAGAGTGGGCTGTTTATACAGAATCATTTCGTT
GTGGGGTCCTGCGAGGAATCTTGCTTAGGTATGACATCATGGTGGTGA


>Contig18352.0.g53(protein)
MFELYTIVDEVILQPGELSDFNLTLENKIKARLLNKVLANEGICVAIKSIKVLEKIIVVG
EGSVQCKVETNLVIFRPIVSEILNAKITLQNEYGIFGVVGCAPVFIPSENLIKPSFYDTL
EKKWLWRYYDESLKQDHDMYFQDGQTIRFRVKELNFTKDYQNRIKQQQNYALQMNQEQNQ
QAIGDTDQNESGLFIQNHFVVGSCEESCLGMTSWW