Identifiers and Description

Gene Model Identifier

Contig3819.0.g3

Standard Name

POLR3F

Aliases

Contig3819_0_g3

Description

RNA polymerase Rpc34 subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05158 ) RNA polymerase Rpc34 subunit
  • ( pfam13404 ) AsnC-type helix-turn-helix domain
  • ( pfam13412 ) Winged helix-turn-helix DNA-binding
  • ( pfam01047 ) MarR family
  • ( pfam05157 ) Type II secretion system (T2SS), protein E, N-terminal domain
  • ( pfam13751 ) Transposase DDE domain
  • ( pfam04182 ) B-block binding subunit of TFIIIC
  • ( pfam13778 ) Domain of unknown function (DUF4174)
  • ( pfam08784 ) Replication protein A C terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003709200.0000000000005000841553255702RNA polymerase Rpc34 subunit f
amily protein
SGDYNR003C0.00000000006996681903814525RPC34 SGDID:S000005286, Chr XI
V from 635297-634344, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3819.0.g3(coding)
ATGGAAGACTTGTATTAAAGAATATTGAATATTTTATAACAAAATCCAAATGGAGTAGAA
GACTAGCTACTAACAGTGGCATTGAAAGACGTAGATGAACTATAAAAAATAGAAGCCATA
AATAAGTTAGTTGAGATCAATCGAGTAGTTTTGTTTACATAAGGAAAGGGACAAAATTTA
GTGTATAGATATTAAAGTGAAGAGCAAGCTCATAAACTAAGAGATCTACTACCAGAAGAT
GTGTTAGTTTATTAAATGATTGAGGAATCTGGTGACAATGGCACCTAAATATAGGATTTA
AAAATCAAGCTCACTCCTCAAGGGTTTAATTCAGTCATTTTAACCAAAATTCTTAAGAAA
ATAGAAAAGAAAGGGTTAATTAAAAAGATCAAGTCCCTTAATAAAAACAACAGATAAGTT
TGGATGTTAATGGAAATAGAGCCTTCTATTAATGTAACAGGTGGATTAATTGGATAAGAA
AACTTTGATTTAGACTCCATTGAAATTATTTAAGAGAGATTATTGGAGTATCTACGCAAA
CAAGGCCCTACATCATACAGAGAGCTATCTTTACACATAAAATAATGTGGAGTCATTCAA
AAGGGTTCAGAGTTCAGAGATGAAGATATCAAGCAAATTATTTAAGTGTTGGTTTATGAT
CAGAAGATAGAGCAGATATAGACAGGTCTTGGGAGTATGATTGGAGGTGCCGATAATATA
GTATATAAATTGAGTAATAATAAGTATCCCCAATAAGTTTACTATACACAGATACCATGT
GCTCATTGCCCTGTAAGGAAGGAATGTGGTCCTAACAATTTAGTTAATCCTAAGTCCTGT
TAATATATCAATGAATGGTTAAGTATTTGA


>Contig3819.0.g3(protein)
MEDLYQRILNILQQNPNGVEDQLLTVALKDVDELQKIEAINKLVEINRVVLFTQGKGQNL
VYRYQSEEQAHKLRDLLPEDVLVYQMIEESGDNGTQIQDLKIKLTPQGFNSVILTKILKK
IEKKGLIKKIKSLNKNNRQVWMLMEIEPSINVTGGLIGQENFDLDSIEIIQERLLEYLRK
QGPTSYRELSLHIKQCGVIQKGSEFRDEDIKQIIQVLVYDQKIEQIQTGLGSMIGGADNI
VYKLSNNKYPQQVYYTQIPCAHCPVRKECGPNNLVNPKSCQYINEWLSI