Identifiers and Description

Gene Model Identifier

Contig4141.0.g40

Standard Name

POLR3D

Aliases

Contig4141_0_g40

Description

RNA polymerase III RPC4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL150W0.0004000184047659232RPC53 SGDID:S000002309, Chr IV
from 183343-184611, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4141.0.g40(coding)
ATGGTGAAAAATACAAAGCCCCTAGCAAGCAAATAAGATCCTAAGAATACCTAACAATAA
AAAGACACTTCCAGATCAAAATCTCCCCCAAAAACTTCTAAAGCCTCAGCTAAGACAGTT
TAAAAGGAAGATATAAAGTAAGTTTAAGATAAAAGATCAAAATCAGGAACTACTAAGCAA
ACTAGAGCTGCTAAAGTGGAGGAAGAGGAGATCCATTCCCCTGTCATTTTACACAAATAA
AACTCAAGGTCATTGAGGAGAGACACATCAGTGAATTAAGACAAGGATGAGGAAGTCAAG
CAGACTAGAAACGGCAAGTCATAGGATAAGAAAGTTCAAGGCAATACTTTGTAAAATCAA
GCACAAGCAAAAGATATGATATAGGAGAATGATAAGTCAAGTAAAAATTCAAAGAGCAAG
CAAAACACAGAGGTGGCTAGATCAAAGAGCAAAGGAAAATCTAATAACAACAATGAATAT
GAGATAATTCAACCACAACTTGATAAGAAGTAAAGTGTCGCGAGCAGTTCAAGCAGGGGT
AGATCCAAAATTATTAAGGAAGAACCAGTAATTGAAAACACAGTTGTTGAATAGGATGTA
AAGATGAGAAGTGCATCAAGGAGCTAATCTCCTGATCCAGTTAATAAATAATAGAAGCAA
GCAAATATCAAAGATGAAAAGTAAGATGCTAAGAAATAGAACTTGAAATCAGTGAAGCCT
GAGAAAAACAAAGTGGAATTTGATGAACCTATGCAAATTGATACTTCAACCAGAAATAAA
GACTAGTAAATCAAGAATGAAAAGTAATTACTTAAATAAGATGTAAAGAAAATCATTGAG
CAGCCAAAGAGCCTAGTCAATCACACATAGAAAATATCAATGACACCTACTCACTCTAAT
TTCATTGAATTCAATAAACTTGTTTCAAATCTCTTGAACCCTACTTCAGCTGCGTCCCTC
TAAAACTAAGCTTAATCTACTAGTTAAAGCAATTATAGTGACATTTTACCAAGTCTGGCT
GGGTTTTCACATACTGCTGGCCCCCAATTAAATCCGTTTGCCTAAAATTATACTCATAAG
TTTACTCCTAAAGTAGATAAGCTACTGCATCCAGTTCATAATAGATCAGTAGAAAGATCA
GGAGGCATTTCAGGTTTGGGAGATAATCCACATACCTTTGGCAATATGTAATTGTAAACT
ATTGAACAGCTGTAATTAAAGAGAAAGACTTCCCTAGATGATTCTTATTCAATTTCTCAC
TCAATGCAATTACAGGGGCAAGGTTAAAATGATTCTAATTTGCTAGAGAGAGCCATTCTA
GGTGGCCCTTAGAAACACATCAACAGACAGGAGGCATTTGCTAGAGCTGGAAAAATTAAA
CCTGGATAGACTAATGGTTAGGGTGTAAATGCAAATGGAATGCCTGGACAATTTGGTGAC
AAGAAGAGCCTAATGTAAATGGCAGCTCTGGGAAATTTCTAAGGAGTAAAGGCAGGTTAA
CCAGCCCAATTTTCAAAATAAGATTTGTTGAAAGATAAAGAGATCAAGAACAAAAAAGCA
TTGCAAGAAAATTCCCTAGTTCAATTCGCTGAAAATCAACCAGATCTCTATGCCCCCATT
ACTCTTCCATTTTTCAATTAATACAAGCAAGATTAAGAAAAATTAGAATAGTAAAATATA
GACTTAAAAAATGGTGGTGTCTCTTTGAAACAAGAAAAGCATGTGAAAGAAGAGGACAGC
TCTATTATGAAGCTACGCTAAGTTGAGAGTTATAAGGACGAAAGCGGAGAATTGAGAGAT
TTACTGATTAAAAATGAAAATGGTCAAATTTAATAATCAATTAGCGAATTGGAGCCATTT
TTAATATAGCTCCCCTCTACTTTGCCATTTAACCTAGATGAAAAGCCTAGTCATAGCTCT
AATAAAAATCAAACAGATTATAAATCAAGCACAAATTAAATTGAAAGACTTATTGAAAAC
TTAAACATTAATAGCAAGGATGAATAAGTTGATCCCCCAAAGATTGGTAAAATCAGAATA
ATGAAAAGCGGAAAGGTAGTTCTTAGAATGCAAGATCCCAATGATCAAAGTCAATACATT
GACTTTGAGCTTATTAAAGGAATACAAACTAACTTCTATCAAGAACTCATTAGTGTAGAT
GTTCAAAAGTCTTAGGCACACTTCTTAGCTCCATTAAATCATAAACTAATAGCTACACCA
GATTTGGATTCTATTTTCGTTTGA


>Contig4141.0.g40(protein)
MVKNTKPLASKQDPKNTQQQKDTSRSKSPPKTSKASAKTVQKEDIKQVQDKRSKSGTTKQ
TRAAKVEEEEIHSPVILHKQNSRSLRRDTSVNQDKDEEVKQTRNGKSQDKKVQGNTLQNQ
AQAKDMIQENDKSSKNSKSKQNTEVARSKSKGKSNNNNEYEIIQPQLDKKQSVASSSSRG
RSKIIKEEPVIENTVVEQDVKMRSASRSQSPDPVNKQQKQANIKDEKQDAKKQNLKSVKP
EKNKVEFDEPMQIDTSTRNKDQQIKNEKQLLKQDVKKIIEQPKSLVNHTQKISMTPTHSN
FIEFNKLVSNLLNPTSAASLQNQAQSTSQSNYSDILPSLAGFSHTAGPQLNPFAQNYTHK
FTPKVDKLLHPVHNRSVERSGGISGLGDNPHTFGNMQLQTIEQLQLKRKTSLDDSYSISH
SMQLQGQGQNDSNLLERAILGGPQKHINRQEAFARAGKIKPGQTNGQGVNANGMPGQFGD
KKSLMQMAALGNFQGVKAGQPAQFSKQDLLKDKEIKNKKALQENSLVQFAENQPDLYAPI
TLPFFNQYKQDQEKLEQQNIDLKNGGVSLKQEKHVKEEDSSIMKLRQVESYKDESGELRD
LLIKNENGQIQQSISELEPFLIQLPSTLPFNLDEKPSHSSNKNQTDYKSSTNQIERLIEN
LNINSKDEQVDPPKIGKIRIMKSGKVVLRMQDPNDQSQYIDFELIKGIQTNFYQELISVD
VQKSQAHFLAPLNHKLIATPDLDSIFV