Identifiers and Description

Gene Model Identifier

Contig21914.0.g47

Standard Name

POLR3A

Aliases

Contig21914_0_g47

Description

RNA polymerase Rpb1, domain 5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000373409.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein
SGDYOR116C9.997093137033517e-262RPO31 SGDID:S000005642, Chr XV
from 544145-539763, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21914.0.g47(coding)
ATGGGAACCCCTTAAAAAGGCGGTCCATTAGATACTAGGATGGGTATCTCAGAGAGAGGA
AAGTTTTGTGAAACTTGCAAGAAAGCATTGGCTGATTGCCCAGGTCATTTTGGATATGTA
AAACTTGAACTTCCAGTGTTTCATGTTGGTTATTTCAAGCACAGTGTCAACATCTTGCAA
TGTACATGCAAAGAGTGCAGCAATTTACTTCTTGATGATGTTGAAAAGGTTAAATATATT
AGGTAAATGAGAGCTAGAAATGACTCTTAAGCAAGGATTGCATTATTCAAGACTATTGTG
GCTTAATGCAAGAAGGTTAAAATTTGCCCACATTGTGGTTTTTACAATGGAACTGTCAAG
AAAATGCCAAACTTTCCCACTAGAATCATTCATGATAAATACAAGGGAGGTAAGGGTGCT
GATTAGGATGATCTTATAAATGAATTTTCACACGTGATGTCTCTTAATGGAAATATTGAA
GCCAGTTTGAAGAGCTCTTATGAAGAACTTGATCCTTAGAAAGTTTACAATATTTTTTCA
AGAATCAAGGATGAGAATGTGATATTATTTGATATGGATCACAAACTTTGCAAGCCTATA
GATATGCTGATTACACATATCCCTGTTCCTCCAGTACCTATTAGACCCTCAGTTGCAGTC
TCTGCTAATACAACAAATGAAGATGATCTGACTGTTAAAATGGCAGAAATCATCTAACTT
AATAATTTAATTAAGATCAGTATTGATCAAGGTCTAGCTCCCAGTAAGCTTATTGAAGAC
TGGCTTCTTTTGCAGTATACAATCGCCTAATACTTCAACAGTGAAACTCCAGGCTTACCT
CATAACTTATTGGGTAATAAACAAATCAGAGCTTTAAGTTAAAGATTAAAGGGAAAACAT
GGTAGATTCAGACAAAATTTATCAGGAAAAAGAGTAGATTTTACAGGAAGAACTGTCATC
TCTCCTGATCCAAATTGTGCCATTGATGAAGTTATGATTCCAATTTACATTGCAAAGAAC
TTAACTTTCCCTGAGAGAGTCAACTAGTACAATATTGATAAATTGAGAAATCTCGTAAAG
ATAGGTCCAGATGTTCATCCAGGAGCAAATTATGTTGAATCTTAAGATGGAAATAAAGTT
TTATTACAGTACGCAAACAGAAGAAAGGCTGCTGAAGAGCTAAAAATTGGTGATATTGTA
GAGAGACATTTAGAAAATGGAGACGTAGTATTGTTCAACAGGCAACCTAGTTTACATAGA
GTCTCAATTATGGCTCATAGAGCAAGAGTTATGCCATCAAGAACTTTAAGATTTAACGAA
TGCGTTTGTACTCCTTATAATGCAGATTTTGATGGTGATGAAATGAATATACATTTACCT
TAATCTGAAGAAGCAAGAGCAGAAGCTAGAATCCTTATGGATGTAAAATAAAATTTACTT
ATTCCCAGATCTGGAGAGCCACTTATCGCTCCAACCCAAGATTTCCTTACTTCAAGTTAT
TTGATAACATAGAAAGATAAATTCCTGAATAGAAATGAATTTATGCAAATATGCGCATAC
TTCTGGGATGCTAATGAAAAGATTGAAATTCCACCTCCAACAATTATTAAGCCTGTTGAG
CTCTGGACAGGTAAATAAATCATAAACGTGCTTCTTAGACCAAACAGAAAATCGTATGTT
TATGTTAACACAGTTGTAAAGGAAAGAAATTATTCAGGAGTAGGAGAGCACATGTGCCCA
AATGATGGATGGGTAATTTTCCAAAACTCTGAATTGATCTGTGGAAACTTGTGTAAGACA
ACAATGGGAAGTGGTTCAAAAACTGGCTTATTCTATTCTCTTTAAAGGGACAATTCTGTT
GAAGTCGCTGCTTAATGCATGCTTAGAGTTGCAAAGTTTTCTGCAAGATGGATCGGAAGT
CATGGAATGTCTATTGGAATAAGTGATGTCACACCATTTGGCTTACTTATTGAAGAAAAG
TAGAAACTTCTTGAAGCAGGATATGTTAACTGTGATAAGCTGATTGAACAATATAAGCAA
GGCAAACTTGTATTAAAGGCTGGTTGCAATCCAGAATAAACACTTGAATCTTACTTGAAT
GGTGAACTCAGTAAAATTAGAGATAAAGCTGGAGATATTTTGAAATCTAAGCTACCTAAG
TATAATTCTCCATTGATCATGGCAATTTGTGGTTCTAAAGGTTCAAATATCAATTTGTGT
CAGATGATTGCCTTAGTTGGTTAATAAACTGTAAATGGGCAAAGAATGCCAAATGGTTTC
TTCGATAGAAGTTTACCACATTTTGAACCATATTCCAAGTATCCAGCATCTAAAGGTTTC
GTAGGTAATAGTTTTTATTCTGGCTTAACTGCAACTGAGTTCTTTTTCCATACTATTGGT
GGAAGAGAAGGTTTAGTTGATACTGCTGTAAAGACTGCAGAAACAGGATACATGCAAAGA
AGACTCATGAAAGCCCTTGAAGATCTTTCTGTCAAATATGACGATACAGTGAGAACAAGT
ACAGAACACATTATTCAATTCTAGTATGGAGATGATGGTTTAGACCCTATGTTTATGGAT
GATAATAGTCTTCCTGTCAGTTTAAAAAGATTAATGATTATGATTAAGGAAAACACAAAA
CAGACAGCTAAAGTCATAAATGAAGATATCTTATTGCCTTTTTAAATTGATCAGTTCAAG
GATAAAATTTATGAAATTTGTCCAGTTAAAAATATCAGCATGAAATTTATCGAACAATTT
AAAGAGTTTCTTGACACTATTATAAATCAAGTTGCTAAATAGAGAACTGATCTAGGTCTC
AAGGATGGCTTAAAATAAATACCTACAGAGTAAGAAATTAAAAAAGAAAGGTTCGATAAA
GTTGTCCAAAAATTACTCAGAAACTTTACTTTCTTAACTTTAAGTTAACTTGAAGATTTC
ACTAATTTAGTTTGGCTAAAATACAGAAGAGCCTAAATTCAACCAGGCGAAGCCGTTGGT
GCGGTCGCAGCACAATCTATTGGTGAACCAGGAACCTAAATGACTTTAAAGACTTTCCAT
TTTGCTGGTGTCGCTTCTATGAATGTAACTCTTGGAGTCCCAAGAATAAAGGAAATTATT
AATGCCACTAAGGAAATCAGCACTCCAATTATCTCTGCTAGACTTGTTAATGATGTTGAT
CTTATATCTGCAAGAATTGTTAAAGGAAGAATAGAAAAGACTAAGTTAGGAGATATTGCA
AAATATATTAAGGAAGTTTATACTCCAAGAGGATGTTATCTTGAGGTGAAGCTAGATATC
GACGCCATAACTGCATTAAAGTTAGAGCTAACAATTCATGATGTGAAAAATGCAATTATT
AAGACACCAAAGATTAAAGTTAAGGAAAATAAAATAGAGGTCATCGATCATAGAGTTGTT
CATATTCAGCCACATGATACTACAAGAGATAACATGTATTTTAGCATGCAATAATTGAAA
AATATGTTGCCTAATGTTAGTGTTAAAGGTATCCCAACAGTTGTAAGAGCCGTAATTTCA
AAACAGGAATAAGACCAATCAAAACATCACTTACTTGTCGAAGGTTATGGACTAAAGCAA
GTAATGTCAACTCCTGGTATCGATTTCAGATCAACAAAATCTAATCACGTTATTGAAACT
GAACAAGTTTTGGGTATCGAAGCTGCAAGACAAACAATCATCAACGAAATCCAATATACC
ATGCAGTCTCATGGTATGAATATTGATCCAAGACATATTTAGCTACTTGCAGATATCATG
ACTTTTAAAGGATAAGTATTAGGTATTACTAGATTTGGAGTTTCTAAAATGAAGAATTCA
ACTTTAATGCTTGCTAGTTTTGAAATGACAACTGACCATCTCTACGATTCAGCAGTGCAT
TGCAAGAAAGATGAAATTTCTGGAGTTTCAGAATGCATCATTATGGGCAACATGATCCCT
ATCGGTACAGGTCTTTTCAAAGTAGTTTATGATGAAACTATAAAACAAGATGACCATCCA
GGTTTGCTTGTATCTAATGAAGATGCAGGGGATGAAGATTTAATATTTGACAATATCCAA
GATATGATAGTCACATGA


>Contig21914.0.g47(protein)
MGTPQKGGPLDTRMGISERGKFCETCKKALADCPGHFGYVKLELPVFHVGYFKHSVNILQ
CTCKECSNLLLDDVEKVKYIRQMRARNDSQARIALFKTIVAQCKKVKICPHCGFYNGTVK
KMPNFPTRIIHDKYKGGKGADQDDLINEFSHVMSLNGNIEASLKSSYEELDPQKVYNIFS
RIKDENVILFDMDHKLCKPIDMLITHIPVPPVPIRPSVAVSANTTNEDDLTVKMAEIIQL
NNLIKISIDQGLAPSKLIEDWLLLQYTIAQYFNSETPGLPHNLLGNKQIRALSQRLKGKH
GRFRQNLSGKRVDFTGRTVISPDPNCAIDEVMIPIYIAKNLTFPERVNQYNIDKLRNLVK
IGPDVHPGANYVESQDGNKVLLQYANRRKAAEELKIGDIVERHLENGDVVLFNRQPSLHR
VSIMAHRARVMPSRTLRFNECVCTPYNADFDGDEMNIHLPQSEEARAEARILMDVKQNLL
IPRSGEPLIAPTQDFLTSSYLITQKDKFLNRNEFMQICAYFWDANEKIEIPPPTIIKPVE
LWTGKQIINVLLRPNRKSYVYVNTVVKERNYSGVGEHMCPNDGWVIFQNSELICGNLCKT
TMGSGSKTGLFYSLQRDNSVEVAAQCMLRVAKFSARWIGSHGMSIGISDVTPFGLLIEEK
QKLLEAGYVNCDKLIEQYKQGKLVLKAGCNPEQTLESYLNGELSKIRDKAGDILKSKLPK
YNSPLIMAICGSKGSNINLCQMIALVGQQTVNGQRMPNGFFDRSLPHFEPYSKYPASKGF
VGNSFYSGLTATEFFFHTIGGREGLVDTAVKTAETGYMQRRLMKALEDLSVKYDDTVRTS
TEHIIQFQYGDDGLDPMFMDDNSLPVSLKRLMIMIKENTKQTAKVINEDILLPFQIDQFK
DKIYEICPVKNISMKFIEQFKEFLDTIINQVAKQRTDLGLKDGLKQIPTEQEIKKERFDK
VVQKLLRNFTFLTLSQLEDFTNLVWLKYRRAQIQPGEAVGAVAAQSIGEPGTQMTLKTFH
FAGVASMNVTLGVPRIKEIINATKEISTPIISARLVNDVDLISARIVKGRIEKTKLGDIA
KYIKEVYTPRGCYLEVKLDIDAITALKLELTIHDVKNAIIKTPKIKVKENKIEVIDHRVV
HIQPHDTTRDNMYFSMQQLKNMLPNVSVKGIPTVVRAVISKQEQDQSKHHLLVEGYGLKQ
VMSTPGIDFRSTKSNHVIETEQVLGIEAARQTIINEIQYTMQSHGMNIDPRHIQLLADIM
TFKGQVLGITRFGVSKMKNSTLMLASFEMTTDHLYDSAVHCKKDEISGVSECIIMGNMIP
IGTGLFKVVYDETIKQDDHPGLLVSNEDAGDEDLIFDNIQDMIVT